ELF@44 (p@@@@YY$(=Qtd'Z F'EBDBDA4!8D$ FDDDD*`!FDĠEĤ$Fc F>,F-EDDDD4!8D$` FDD"FBDBDA4!8D$ FDD<%bDDa!FBDCE"F$Fc F>,FEc"FDDDD4!8D$` FDD<%D'!%H%P%@%pV%+|@<+@,<+@ $ $H8F!GB!PJ $#`JlPD@%Cplm 1<0X\ %PgF0+XFm  `#8F!PH+H`#8F+FE`#8F1 (C,%+ b !h+ h+ b!h#b %+ @<%% # +0#(%#+k@,<+@$$HPG!@  $!h#`h+@#+@##(+#+$ @<+@@-<+@ $ $HH!CB!PJ $#`JE#(l1 <X\ %PgO+B `!PH+H`#8B+B`!PH#8B1 (O#0+#8:#8# +#(#(2 $@ $>@< $-HPG!@  $!h#`+8x%xX 1(%(e0p@D%@X+ X  ` !@+{@%+ x@%!@#X 0x P@D%8+x  @!8+]@E%+Z@J%!8t%P#8FX+PB@U0B#8@lM 1PD(%(E<p04%0+ M !0+@+@!0#00 ( ,%(+ @!(+@+@!(7#(#0F#xo+(F#(#8#0+ #( %%P%p`%!PH+@0%8<7'!%%P%@S%H+m@<+@<,@$H8f!GB!C $#C@< (EdPF%He@D< ' K104%c +0D'  !J+(Jf$+(DRc$%# D1 (,%@bX+(  !@H+( D$+@ B$%b%+n@%<+m@,<+@$$H@G!hh $!@#PHj@+(+B8%+B$F P<+B@B-<+B@$$H0j!FB $!C#`he#(L K1$   04%8+0G   !J+(J$+(G$% #8G1  (,%@KX+(   !@H+( F$+@ B$$%%-H@G!hh $!@#PH@8G%8Gh\` 0@(E%(tHL %H.@+(` @0F!H'+'@m$%#@(0`  HL %(%h`+`  @!(+n@%%h%M#(F8+0Y`S%h@f$+R@$PL   K1d(%(et@80$% g+   `! +F`$+C`$! # 0  %Ec0+(F   !J+ J)e$+ F&c$!J<#(F.%%$^%% D+`B$%$$%$+@%!(+(r@c$q!H'%%8"!J!J<1'!%@%P%`S%+q@<+ @<,@$H8!GB!@H $#XH`@ePf%`d4 f B1< hHL %@'Mh+H f  #8 !@ + `#8 + 6`#8 1 (C,%+ b !j+ j+ b!j#bb%+_@%<+^@,<+@$$HHG!@  $!#Xb[`+@#+@##(+#+B$F P<+B@B-<+B@$$H !CB!@H $#XH`#(4 M1 < HL %@'M+  `!@ + `#8+`!@ #81 (M%B,HHG!@  $!#Xb`8g`F%`pEl  18D(e%(|0fH@D%@iP+x   d!@ +8 .%%H#P 0M p@D%8n+(M !8+(g%%pL %H.#8&H+@S`j#80#0+ #( Ef%et@r$+G@$Pj4 F M1@(e%(D`d8<%8+ F !8+@+@!8#80 ( ,%(+ @!(+@+@!(>#(#0#`,+(#(#8)$$+(%!8+8 |)%{!@ !@ %+`0%8%% %(%0'  '#%@B$8<@DHLPTX\`d  $(,  $(,8<@DHLPTX\`d$<`*' !h|L %%(@% h|P L <*'!$ T # %a$ $ $$($% '$ '#@' Z<Y$"'Z< $&$ &1$ ('Z[$%  % A%( V<$  % @@<% @F9'$%@% `5@$ $@`B0@@@D@<<9'](23%V<$0W<%  d$V<$$j8@$ % @p $ % @!B,@ 't % @%@ЀV<$ % ' % *@Q< $&B!$BC*$Q<$$dr9' $"V<($ &MV< C"2 @;@S<B@'D % R@V<@<$B9'PT$K@%@@<$$ $xT&d % 5S%@@V< d$l % @<`T9'H $bX9' % `@Q<Ȁ%8%08$ $$'4% $%% %4  % $8 %  %lS<%8%0`$T9' % @MV<􀙏 $G@`%(@@$@@0'R<9' % ( % @%(@R< R&%0@%@ % (4 % %0@% %@%( 'R<% 9' %(@@<% $D9'%(@@%V<@<%0U9'lO$V<%0%(@ $1 %@( % ( V<%0`%(1 $$S<̌9' ( ( %@( %@ "B0b@@<V<U9',$%@@<wB$V<@<UB$5V< %0@%8`8D$ %0%(% @1 %@LS bB0:@W<@<%( pU9'm&(V< @o$(%@L m&(,V<@<;9'H$V<%0%(1 `$%'%V<%01 $%V<%01 $V<R&@$ b<$ % @ P$$ %  6('Z<'L'@d $(܏D¯ % @DŏV<$5 l $R<ԵB$T¯@<\¯@<:B$%%%%`¯L؂TُD P¯(܏@%@vW<$V<6 X $(܏N$6 lJ&(܏ $V<.$b@  &̀%( f0 ! D,% ($ 0'%0F>$p''= % Z $'V $A<'tB$840<%%b'+Q@$> % @%(@q> % 5= % @%(@q> % +Q@<840@'' %A 'A<$+E@@<' % %%PM9'$($ ('', $%@$% "+P@@<$PM9'i%(" 0$ ('' %%$> $" $ #B$c$#C$ ('%! Z<'L'+b $%`%> %(@̀ ! %0  %(!Q!$ ('' @%+E `#(ES< % % '? #(%'+E $%%`%? #(S< % @&2$ ('= #(EZ<'L'$V % %('Z<LPZ<L'($, % %Z<$QtV<@<%( U9'o $$B@<%0%(=9'% `@Z<$ $,($ 0'' Z %X % `@ TV<.@ $<840,($@'R&&V<.@ $%+`%$!8!b@!8+@V<.@ $%`@V<.@ $g@V<.@( $ , @$c,`% $%(, `%%(V<'@ D $$ '%(V<.@` $V<@p $'Z<L'!$ % % #c$!b$"%  @ % Ѐ%(` ! ,($ 0''Z %  %0  %(@$ % >(''Z<LP$$ f$_$%`D$,#C$ ,%( B$@ &$1&!Q ('Z<'L'H@8LD<%%&% '$%(@ % P% d% @= $`%8%0@%( % `']= 00LHD@<8P'd> % @%% '$ % '%P%0%@,; A< B$%0@.A % ,0''B8b$A<$#b#@ +Ph@%+@IB$% B$!b.A $$('A< $'%P%0%@,; A< B$%0@.A % ,0''%P%0%@,; A< xB$%0@.A % ,0''C$B$A<B$.A $('Z<'% L'$ > %"&"$$   (''$ @%%A % @B8$ %('@%H%(A %  +(G%@%+`%P@%P#2%(`#%(!0!`%8-$!@'#("#8+@%h%%h`%(%8@% `%`%H% $!#X&+Xc`!( $+0e%!d@e$!b#G!b $k% #)%!k!bN $%!0ƀ!D !0c$8Ǡ'(,$ %@%A % `@B8,($ %0'%@%X%(A % ; , @r#b+ C%`@%`2%X %@%(`A % %+ E#E#(? % %&%; ! S< % `%(`R:' %Z   %(%H%8 $Z <+/@%%(A % %f !0!PGƀJ$0!0!F`K 0j!0+P@! !(E+! F+$@%Hh؂@$$ %( '% = '%( % = '%( = % %( = % h'%( % @= |'% @%( T'= @'%( % `= ,'%( = % @%( = % @('= % % `%8B %0% %8B %0%8%(D % ;@% %8%(D % 3@%0`%(E % /@% E %0@(@%0%(E % #@%0 %8%(`}A % @@%0@%8%(}A % @% $$(E;? % `@% ;? % @ @%0 %8%(@D % `@%0%8%(D % % ]= ]= % ]= % @]= % `]= ]= ]= % ]= % ]= % ]= % 'HZ % @B+P `%( FD#0 ! B!PBǒP%( W? % @]= % ]= % d%``\XTPLHDh'Z<'L'TPLHD@<8@V<.@ $TPLHD@<8X'%%`%%$C%`c b%(A % '%(W? % %%0%( ; % '%(@= % `%(A % `2 +R@E&> % ` % `? #(E%+E`#(? % `"#(+@#(? % `#" b@"R&!RB@R&$ $> % ` % b$ !C@ > # #0%( ! & Z <+ @%'%(% W? 0]= % `0p%@!H'!X2b%@%@@D$!$!0cƀ#f`a# A%0@!GHhB @$+%0@; % %FF%$'@<TPLHD84hl@%V<.@ $%@T% PLHD@<84X'@%%%' %= % %8`%0%(F % $@%@`%8`%@%8`%0%(DF % @%@%8`%0%(}A % @%@+@@#(E? % ǒ%(@W? % ]= % 'D!+XTPL\H%%%`%%@%0%(`; % @ '%(@= % %8%0 %(`G % @% ]= 8\8XTPLHD`''\HxZ % % '%@%0%(% % %%''%0%%% < $\'E% = H'E% `= 4'%(= % BE '#(= % %(@A % % ; p'$%(|% '> p`= % %8%0`%( }A % @@%@'d`%8+b"@%(`BR@$]= % ]= % ]= % `]= % = % %0 %( H % C@@ % >@q> % % ; D%0 %(c$%(jA % `)@@ % `$@> % %8%0`%( }A % `@ %(%8%0%(jA %  @G(+@%0`'%@Z<'L'( %%,$= %" Q%(`q> % $,($ 0'%@ XBd!CE @"$*> %  D̀!"$#0%( ! $0  ̀%(` % $'Z<(LPZ<L'0% ''&,4 I @%@ % @ b!bd  ; %@= % @= % 4 0,(8't> Z % `< x&$BCb$2bV<􀙏  $,@@ % ,%`(,C@`C$V< $q> % u? $= % 7= % 耙 % @@<$@<j$ n9'C$$D@<840H' $%(Dz9'C% @%@ R$BA@<1&B4+"< R<=\9't> A lf&,@'Z % `%(`q> %  4C@!,@ $% H'%Z % @.$p % %@@!3c$#C$@B$$CB0@&$b.$#b$ D,  $ c$ $@b bҮ_s&!3B B$B0!d% @ B,@ $d B$ `s&!3BE!3T'5= % '$8x'$%(h'% &.$,',> 1&"@W:D,C$C$+t@%@%@`%8%0%(% @jA @%(> % `%8%0@%(`D % @1&]= % Ү @'= % `; % ,'% #&%@:D,C$C$+t@%@%@`%8%0`%(% `jA @> %(%8%0`D % `@%8%0%(jA % @#]= % `%8`%0`%(% `A @%8`%0@%(`D % @@  @+@#(e? % @8iJ +(; % @$$ D%@ D % @%@+"@%&> %  "!QѮZD"%@% @ % @t% plhd`x' $bV<b.@HC P $$LP'Z % LC&Z<|B$!g %0@%@, `Z % TPLHD@<840X'X%(@ &@X@ % '%$ $hb@d % @@%@ ^E00 % @@V<@<,<9'n $% @ ((% % q> +LآEV<@<,<9'U $'Z<LPB@ O x&x|B,@B ''O @Z Z<$BCb$bF$Z$.t:$.\$ $.$Q& .$6"&C wB$B$O %@"&B0 B,@A". @+ @.$q> % @% B$>.$$b[; % @> % @Dt@<840,($ %H'Z % @$('' X % `<840,($ @'; % `P!PBB0+ T@' &KP 0[; % `% :+ #DЯ', ,($ @%%$<$ p B$q> ',($ 0'B$'% 'q> %(@% q> '$KP Z '%(@P $$ (''Z<`LTtplhd\XT@P@ %@t%`plhd`\XTPx'&%% %; ,%@BB8B,E%(@d@ %@iJ % %@$CD'@'408<@0' 4= %(% q> %J % @%@%(@iJ % %@ @'5= % DA % %(q> % [; % D$ " C$$"B%0$> % ; % %> % "2 %"+@%(E= % %(@% A &&R&C$*B%%0$% < HH@$iJ 0%(@% iJ %@0'0&N %@<1C0% !bEP 1&%( P % &%F> %  D % %@' Z<LQZ<"L',($<840t""X ®> % $¢O @%<840,($ @'LPO % @/$ 0,W@%$&,(@, @ ,@ $  $|$!$}",@ $$|< "$#$V$>,@A,@O ,{, @a,@]$],@^$$Q$|$|,@}$$$B$$:<  $$4bW % B$> % B$t#$b%$< BDV % ŽB$®!B$E¢#$ŽB$®$>$ $ $!$ C&> % ŽB$®Žt®^ŽB$®|< ŽB$ A ®Z <$Q $ (''Z< $LPQ @$$ nC('@ $ ('' %$KP %  %xT @$ ('KP =$KP $KP 1$%'Z<,LP40$CC$Q  `X D&t> 0; ,Q @$bP $P {%$3D8,%0$>$D$$%(0'Z<LP@T @ ''8Z<@'$LPLHD<\XT$ B%,"2B4dU%$% (%0W .@<24$$E@&B06E,V<e$!B@%0$V `&$$Gb% '%(XP $$D$,B$B,e@$$ $ `C$ bkC W$b(&B,!b(&B0 '%(% XP $c8+$%% `'$< @q> `D&&`$$Ld+ @kC %@&%$<$`&; % B$ $C[; % %D$0KP 4[; % 4 ^%0B8+0# d+@; % B $`$< @$'W %2%@$ .8B$ ,%%`$< ~@P $$ %B$ $`p$< k@&0KP $`a$< \@LQ @%@ $ bnC %@ %B$ $%% Q @%@0]U @%@Â!$b3$&$$$KP $`/$< *@LQ @%@ $bnC %@%$$Q @%@Â!$bKP %$%$` $< @LQ @%@ $ b"$"$KP $ B$ $Q $32@%@]U % `@%@!$bnC %@KP $Q nC 3%%$%`V&$dB+@$$b $b"2+@(@V<12/ %; % P&&B,@.&KP 0 %:+#C% [; V $%@B$B&"TST&]U $@%@#&$bQ @%@P -$L3&%(P ,$'q> % `,$!$$q> $"ETV<]U % @%@"TKP 1$%(@P ,$,$'$82&q> $%(q> % @,$%(q> $V $%(@-$P V $%(@,$P < V $''B$% @83&q> %(q> % `,$%(q> $]U $@%@#!$bP -$V'% @; DD; 0<B4V<B$xA<|@ '[; % (%,+b@%D; D; 0<B4h@$ 5= $'% `EDiJ s&% @[; R& 'L $'@%@ ; l'%@[; '@04< E$04< E$< cC<c!bB0bphB@%j04I$< %( 4%( < %@% @; %@B@V<.@ $%@deEV<%0@@ $%T&4u(bVU '!U,b+B!@'L$$q> X#u; !UBB8$c,B,bd@ P m@%@&iJ %@ @$5= % %(% q> R&&> % %('L '@%@S&s. ` $$'E% = A %  $@$T:+&L$'q> $KN % @%@t`e ''''L '@%@$'5= % `$B$L+lk%; %(`@; %(`@> '? BL+lk%; %(`@; % `R&; R2C.`V<c$!rC`B,B('*'< % `% `EO '; $; % @L2 t$%(@ % 7= $NT @%@\$BCb$b]U % @%@BB0@V %8%004J E$%@04@ E$$$ B$ L$ '$q> 'L '@%@@ ' @%@AV<.@ 4$@%@$ n($8 $''B& $ B$'L"R5= % `%(@> % `"$BL"R$'L"R$'L5@@ >%@; &% @'J %@@%@B$B, @$$D  B@$$B$'d@ %@$'% @5= 8&$B$$bdB$#D+0B%(%($8> !(Er @,4( '= b@V<.@  $%@$vB+bB R+8; %(8?  '@%R&!V'%(@% = '%(@= % $''; $%(@'= '% @%(@= L; % eb#( 0@$$b$$$($? % &B$!Rh ]$D @D%(@@B$! ; D %(@%( $04< E$@[; '3%(-M % @%@?$'''L '@%@$'5= % `R&Z % '= % @'Ŏ% @8= 'Ŏ= % `'$% @('L; $% ; (% %8%0@G %( @%@8%(A $ @%8`]= % `8]= ]= % @8L H % (@V%8%0`%(@jA % @@%8%0@%(G % `@@BV%0`%(@jA % @%8%0%(G % `@%8%@% '''L '}@%@'5= % @$'E= % `L4%8@ H %0`@%@> ''%&]= % `% @0L3U$b@@ t&; % %@6$LB$4@ %(%@04B!bc+`B$0b% Ž)@%'%  % @ % %PB@P B@d@ %@[; % 4@ %(%@% @iJ %(; % @P$PW&Ž4C$׎&; % %@B<@ ' t$%(` % @7= % ; % DNT @%@LU @%@KP 2$b@kC %@= t$ %(@ % `; % C 'J % @%@ D D% $[; %(@{d&%; ')L2$'T% `5= %(> % ` 'bD& @'@ %@< H; % @%@$B C, `$C b0@b0@c0 `@<'@% @ e'= % e&A % 'dM9' $e& 'B,@'% `; %(% `$%@; $' %(% `$ %@%(@ %  $$ %(` % @L3bM@; d&% @'J %@9@%@Cb$B,<@$C`' B<@5= % @A % @% @= '$,$'% > %8%0@%(A % @@%@'@ % @@%@]= % @HdDb%D $T'Dd&q> $ ( bD; BTDCec`R&B$L$@; $% @ 'J %@@%@Cb$B,@$ @ @|$G$RH $%@ bD; D4e $ D>G:,N$04@ E$% @%(P %@%@o% @B,@0C Dh; $'L '@%@@ '@%@L2[; D&B + EEh; D& C b@V<l$\b$$BD@V<|$; <D&; PD&Q @; % @`@@; D&; X&'Z % %%(@<840,($ @'Z<'L'Rl$%D &%@$V<B$2 %0`$%LHD@<840,(P'Ȃ%D <4s&@b n$$%$*$ȂD %@D% %@ /K$ % T 1&%0/K$ %  $T % @$Z<hC' R<0,($48%%%\$^$tFR&$8b @4#0,($ 8' Td$8b@c$CN$$b8B$8Cs$C-$C%@ 8'8c$8&Ub$8bB$B0% $'Z@A$B0'8$8%;$0$BŠw5A 0C$,ì01$F;$FB$665$F;$FB$0 3$V<F@$f0!0ƐB$F;$Fp0 4$EV<c0@$!ecB$CDm$Cg @$< L$8b B$8b(''Z<LQ4,( <80$ "N6$2#("@&%%&*V<@<%(@9' $XCC#QQR$b$[V$%9M@$K\HVB$:ȂD W$v K"H"'9W$ Bv `$&@K$BA$v X$&;ECB:B,%CECyB:B,%CCDYB:B,%CDzB:B,%CBZB:B,%CBU$BQ$v |$&prB:B,nx$ Bb$v x$&oBrB:v $$& B$%(v t$& mR$ Bv $&qB!bB@% % @%Ȁ ""BB$!bB@% % @%Ȁ s&""&H%9's&du b@%<840,($ @'Bc$v $& tB:B,%CTC:c,%e%C%S$>B$%(v P$&<L$VBW$v d$&_ABL$v T$&X=Z<'L'%V<($ 4-$,%% %Z&t$*2@$1&$p'Z@( % $ ,$% @ (B $C % % @&, 00%B$%%@܀$$ % (,E@0$,$!DBE  $ȓ$$,'Dإ0$EE$ ,E$0m$EmB8+$⢍, $H$$$$(*0e$, $OD$L7S<89' $% 8⮀ !^@<&PM9' E$B$¯8⎀!CBD@B$⎘<c4+C&@((KA C $>b$(L % @$\XTPLHD@<8`'@ $£)' @*C@L % @*C@(@ B$ P$%W<7 R$@⎻PZ*%@/$0*@)$-$2  % -$ $N$)COC( `E$CM$.CD"B8)D":$`<$kE$F*@>$?$sD"B4G$N$k$m$n**@d$e*@[$\*@R$Y }]$`b$P$g$;h*@e$kf$+j$fk$?$, bu$fv*5@q$gr*@n$p$r$s$(V<7 7$, $%@B@@H**@%$M&*@$/*@$L  % ` $ $<$&=* @/$<$?$0D"B4n$7o*@f* @d*@b$", % `ag$$L Yw$x*@p$u$y$z$ LBPC`cCcd$ @  $LBDc ! d0'ь %&&$%@$$%( $$%%$y$`L%( % $%($ %V<'lJB$Z[$^$C$ c, `V<%(=$0$$d0^$ @!TB'0$C0%@!TC0%C% (% ,% 8X<%( Js$AV<%(=$ % <% @xV<$ %  @4xV<>$ % @%@% % %@H%0$* % %V<=$$%8,\(V<$%(>$ <\8@V< >$V<\ >$HW$V< @%(\,(V< 8>$W$V< V$\W< )$$C$C*$$X<%Ƞ ar$@% \W<%0@%(  x$V<l3v$$$$ '%0$* % @b2@V<0V<%@X<>&T?&~p$%0 $* % @(b2@R@% @t $ % @ %@"&%0   $% !QR“@'% !Q%` ^@!Q% $B!Q"B@%` %  @% @C`V<@<%0@D&@9' D$% @ %`%%Z@|'('@<%(@C9' % V<@<G$%0'4[9' $  @8BbV<8G$ $8' % @V FEBDBDA4!8D$ FDD%(`"FBDBDA4!8D$ FDD<%0 $S<9' % `V<%0@J$B$B,@@<B @@W< UQ@.$t % @% `2@ C`D$40,($%8' #$bV<0V<1&xLR&@@@h!bhl#bl @$X%Ƞ % .@Xlh#b&@$dQ"$!(Q%Ƞ % @!" @$?$dV<$DS$ % ܏G@V<ُ &V<ُ¯LS$ % @E@@<ď$x7'į'%  $ď@D%(`-$b$$$@-D)@ $%(% $܏H LB@$DL* Cb@H+b @$$$TS$ % ܏ @V@@@DbB09@V<4%( b$$ %  % X@ %(@@%@ѯ % $ CDF4 %($$@@¯$<DbB0@V<$bC$%$@<1u*D쀙@$ %( A@< B$C$ <V<@<$bE$,<9' <$$D@T % &B9' % @ %@% @%( ! 81C/@dB$Z<B$8%@U,%`U-$$8. @@%@ $@%@\fV<%(@ e$y@' x& e%#*e`B$b@B$`B$C`#D @V<\%(@ 4e$@ B0@Z<4c$!C\EV< @e$@@B0@V<\ Le$@@S@` % @($`$ %@ ,@%((%Ђ,&$ % @%@%(y& % @ $"@S<9' % @V<@<%(@$k$@9' %@ %  %  $y& % @   X @@$ $  AV<$@%(X  $X@$ď/!#!R+B! !Dү¯ď %#` $G%%@%$#P%0%@&4@$V<@<@9' k$R%Z<'L'@<@A$XTtplhd`\P(0M9'% Z"F'L',(40$%ME%@DDBDBDA4!8D$ FDD % D%@!FV F-EBDBDA4!8D$ FDD 4SB0%@(,$8'DD FBDBDA4!8D$ FDD<%"FBDBDA4!8D$ FDD<% X''R<%$%% 1&@% R<9' F%(%  % %(% %  0$R<%(`% 9' 'R<<9' F%(%  % %(% %  0$R<%(`% ,9''ZB0B4Z FL'0E%8B,@%@ FBEBDBDA4!8D$ FDDXƸ\Ƽc,F Fp FV<B C,F"F ,FV4Ft <@EDBDBDA4!8D$ FDD0 % DV4FvE%@BDBDA4!8D$ FDD 0Ơ Ƥ! >4F,mE.BDBDA4!8D$ FDD0 % D !F F F !>4F\E%@DDDD4!8D$ FDD0 x x2@⎨00V 4S<@@$%0%(9' %  V<@<;9' u$  FBDBDA4!8D$ FDD8F?:F FDDD DD(D0< "F4EDD07@4V<0B4C"FDD<"F)EV<8@"FEC,`%(@$%(@w & V<DD< FEDD@“A“Dė@D8<Fҗ 8܏% @ %@DV<DġFED$F!F8܏HėJӗ FH L8܏% ` %@D!F$FDLďF%("FP`T$B$E (V<:F>F @@p#c,`$8#c,`@@F#<ePhā$FTi`fĂ FE$ s&`$hg@$V%( '@< % @$PZ9' %@$ S8F E@ B,%" LČ $>8F E@ $w (ƌP %B@$! ' (0!E FtEBDBDA4!8D$ FDDC @B0($%&2B+0!BD 12WT @0 $S<9' %(%@  @S<C"b2& S<2&s&%` % @([XWV<\Tdz$ %0@ ( %` $(W<\%(@ $(\ V< tz$(# $l%b$:$$ $ (&A@< C$bX FBCKE '"FV<($@$ % @V<\%(@ H$*&@@ F EV<`BVR&&\%% @ 1&0@ @@<B@V<$$V<\ $@ %!qB$$ (''%6> "% 6> ''%R> $% R> ''%6> $% R> 'Z ' X<\W<CC$ć$ $> ' ''$Z @ $\ ICfC,`c$6CW<%  D$h(@> $l$Cz$C> $܃ % s> W Ch> 44h> > ,(h$0'h@XC@c4> Ch> 44> % Z  'ài$Π%0$jmˠ̠Z  $@$&%` % @> % \ -? % @&@$&%` $ @%@W<@ $@$% $!B$C2&D$%@@ $b @<%0 %%@@<%0 &g9' $$$c0e,B$!c`$@$C!$b $C1&$C,`C, `$C$!$C$1&R&$$OCC, `$C$7C$^d4?! D$HC'$C4@'42'4$.b4$b$D0$$d$B8B0@44h> > % N&$D0$$dB8B0@44h>  @44h> 44h> (($]> ! R> 4$d4! D$7$D$C'$ }<]> $ēR> 4)R&6> 'mCg@<]> '$U<]> ES$R> R$ē6> '$IC8$Z"%B$B09$`$'Z& ':W<@<@9' p$& % <h% %0O%(@.%$!0b% f#s&$h&(e!C,`4&2@$R&l%(`%8@$$&!rp!&#P#4%$<C$*@$,C2$W<3. @$!W<($@& $u (6@$i((@$Z(@$NW<\ 0$Us& $J$LDŽ@B0$@D &%@08D % ` %8@0\W<%0 t$W<0$&*3@%($$H DD0H DD0H1$! c$*b`$b$! Dޗ 00 $&&\ % 0& 4!06$6DŽ@B0@@$x' E$  $0%@8'E$@$  $% ` %8@0!#W<\%0%( t$W<0(7&&%&V<*'@   $0.",$CP7&P"X7&$C #0C 0C$&3@%(\ % 03@!   $0!\E X &3$0b'*@   $0*C$bB@%( S<9' %@0@%( %(@\W<%0  Ȋ$0 % 0%MW<$W<(BB,1@W<$\ +$(\P@q&(GW<-$$>( @ (7@ (\Cs&W<$ $(@$W< $$$W<$W<$\ W<$\ s&$$W<E\  $s&W<$W< $W<$$ % W<($W<,$0$%(%Ȁ $0'@W<0$`% `@#$b\W< $* @F<0l9'a"% V<\%0@%( $%$\W<$ !G<$s&%`'$4e % @ $Ђ&$ % @%`W<%\ $ G<$9''$W<\%(@ 8$ G<$9''$W<\%(@ @$$F[$@9' ($Tb@XtE$ % @W[$`\ yD$F0$166'$16$$%`% T%@$% $%@DV<%( UD$G<9'G[$@<@9' @Z@$/,B$$C#!C30+C@/+,($B$$D!b &% ` %( %@$b$b74B$b"!b+(#C/,'$B$'$d G<$9'$V<\%(@ $@$ F%C#*b@P@SR%C@#*C@d @gf%C#*b@x@{z%C@#*Cz@(|''|  "~ $$$ }$ '$" $$$ $ 'dG2%044<&<9'% @SR%C@G<&P&<9'% @gf2%044d&<9'% @v{z%Cr@G<&x&<9'% @h0`cCd  $B$$D!b &% ` %( %@$$beB$b"!b #C v#$bW<\ $$$ F$2&G<9'x% S%@G<9'q% R%@8B48G<9'e% %@0%Ȁ<'0@<0=@F<@'$$e9'% >1$'F<[9' % F[$@9'  &@G<% 9'< EF< '(t9'%@@@<%l59' & $CV<~$$G<Ԁ9'C$c,`9'"% V%@1&$CG<9'% ^%@$ C9'% E%@%0@(&%`Xr1&$"CG<9'% E&%Ȁ %@$C $$C$CF<%xw9' '@W<$ $C $%CG<9'% %@$%F$<@1=w@6@'$c,`$B,@$b$2$@@'2=$F<$e9' % &$d9'o% E0F<<'}9'%@>@'1=$D$,G<9'Z% DY$@^9'% %'Z@W%Y<@<69' $AG@0 B0K@W<%(위$W<$@<@9'  D4 D/5$B,@W<$ W<#@<CĜ$;9'P%0%( % P@ D,+ 8B$$I#!H؜'%|xtplhd`\X%'Z<'L'@<M9'h`\X%PtpldT@D $% %r $%@4'@'R& $$4r$(,08<4B4Є'd%0 %(AW<$@<&;9'W<@<@H&@&P $dD%0 %(A C$bW<@<$;9' @W<$@<@9' $ % t% plhd`\XTPx' $%$C(8`0 c0_`W<؜$%ȠW<$@<@9' #& a*(Q0 B0@%( W<,$ dD!c(`W<$W<$ # CQ W<%(  % oĜ$ %Ƞ %0 %( % %LH % 1&$H$%#QL!^@W<%(@위$' b$($$QZZ<'L'($,%@%%0 'c`<+C`B0%( 5 % ,($0'%0@<%(W<'@9' $%0@<%(W<'@9' $'Z%`H%(&% H '&(&'â&%@W<Ԡ$&%ȀdT@%@/ OQMB0@W%@$W<@<@9' $$8 T  #~8!b<d4@ !W$8 ,B@@ d4W<$(H$%@  @*D@W<  8<4 %@$"{ %(A&2<@W<%@ $$8Z%+@%% B=".@=$U$bW<"*|@$UZ<,BB,@@<W<8A9' $Z<'L' %$%%(t$ % @<% t$8h9' %(  A%@Z<,B@W<@<8A9' $ B( @W<@<$8A9' $$% ('Z<,B@W&P@$G<&@<@D&%W&9'B% @W&$8&% @d$9'%@H % .;8 9'=$H8@V<$lJ$5 =$H$?<C? <$B$& % @H$,@W<%( \$   @W< $$HZ$d$9'$>$$('Z<'L'@< $%Dz9' %( BB, 'Z<'L' %$ %@$$%( % Ee`$ % H!C<%840,($ @' `$Ђ! %(` $ @ @!DDD$$%( ! 7'$&dd%8`+@% @%8$$c$%%P$,@S<$%(9' &-$_$.$C`d$ ,  d4$,efGB$ %(` &ZFB,!(섙@ D4F8@\DW<(, $紳$4F0 43G@@FB,!(섙 4F0%0Dv4B4## w+(#b#(eP6FB,!(섙 4F8%8Dx<B<## y+(#b#(eP8FB,!(섙 4F(%(Dz,B,## {+(#b#(eP:FB,!(섙 4Fhx|# C+(D`|}#C#(EP*  $p % @%Ƞ % @%@Q&PW&d&&%0@D؂B0@ $ $@c$$ bh @܃ $dB0q$kr,`o$bp,J`k$$ bh @܃  $u$$x$-t$$b % $$h %(@@܃ %( $  @ % @$$ bh p$@܃ $B4 % $$$$$Z<'L'XS<$% 9' 6@<"@Q&"%Ȁ $&$@<$CR&%@ @< $%@$ B&$$% @< $%$ @  ?W  &%@  %@ !" @$ % @@ 8& @@$ &% '$/,OL $%  $6<Ԃ4$ ' $ $$ %($D'$%` <@%@1WlB$@;8B74;8$=<B0=C@  @& 8&CR&@#B@ $` D$/,$ %($D &@$OL %($D 8&@x$ &<$T>D;8:@$ % 74$B0^$쀙 %  W % @ &g#   & &#' #g $a>> 8&   Z@0@B09@.$Qu$RS8&$ % @ %(d% @ @ BT$W<6&$ɔ& %(@ %  U % $W<1&$Hɔ&쀙$$ % *U(VUW<$ ʔ&$ % `:Uu$R % UW<@<%0 @9' 8ʄ$WUW<1&$R&쀙$$ % 8T(V%0VÓ+$b%0 % (& Ž+$V£E$W£ -$"."-@+$" % B$!(E$"e$"%( &(@Wɣ%( &(@VɣG $((6@$( $$ $$%e$8+=@ $bLb C## %0 ! Y $ % (4@%@X@D$̀%0  %( ( % (@%@ %0@ $ % (@#PB$ !BH!I$DWB ^$G % (+$!IVBC%(  % (&B!Q B@D& ! D ! @  Q $B$B0 B,@B,$Z %$B6@65@5 %b0@a* -%Z@!ЀW<Υ$ ! q "&WZ<$`<!7 !7c, `# >T  1& Qb  $  $@ % V<쀙%( `$&@W<`%&$ X΄$Z<@B@ B@W\$'I%JK“M''\B8B,!EE$BN%$L%Г+!BF$+&!&!%%`D+!&¢@&T$ '@$=. +@%\$DD$D+ !DD$B&¢+@%$#@W<\Є$h @%@“@$&%!B#\B8B,!BB#w$.$B@ $N$Z$$'Z $$ ('Z  @!! &++@4D$ w! C$bB$$b$!bf$Ab%]! #`1&#`D@<840,($ H'\ %  & Wf$bZ<`Dl' %(4%  $ $e!EB(@f$ c$f$O0 % Z<'L'%0G %(e % @P% 'B0@  %  B0@% D8$ $bW<$ $v. $=$C`dB$Z<'L'@<M9'L$H DZ<pc$bb$b$$cT  Nb%( $W< Dc$BCF$G$ČG CìF$+@XPY<h =$$% $Y<$% $@< D1&%  % @W<%(@$t& W$D>$ "$ DW<ӄ$|' $.@@W<ӄ$"@W<ӄ$q&#@Z<$$<$C>$ @@ % ܏B@ @ÓZ$%@$YQ W|$$0C&$$C$$ $>$$D $YQ <$C!Q&$C$. $%@$$. Z<PYQ "-$C$" C@Z$,($ % %8%0%(uQ0'Y<&' Z % d. %  @%  W<`Մ$> W Մ$4 % @4% 0,($ 8'W<EՄ$+ W %<'k\ % $C$C2@ @<'$%(6 % % @R& %0@S%(% %(V<s$ W<Մ$%  % BBB0 @$E,$W<Մ$W<tե$ W<> Մ$$'$ @C-$b$%$!%& % $ ('$$%0@] %(%"'X %( % %(V` $*@(% $%(. % $%0 eF %( @$+b6C4G! <BR@' % DPL2bH" TPB-b8@%(@W[$$30<B$$b<B$b耙 %  @耙 $@$01$b01$#b 1&3 BB!@Q& $BC$QC#`) @W<$ք$Y\ V<3@%@D, %("Z<lb1&<C1&c$C? 0ք$@C`Y\ % @F $ Z<'L'Ѐ%'V< $% @ $쀙 % @A%@'W<@<$%(`i9' 4ل$$@'!" $ % `@S<E$,9' % `0@&`$ % @% '%0 V$ %  @W<U٥$ '%0 T$ % @W<T٥$@<$P9' % @@%@%( % $ % $ % * @$T$ % RЮX ! ~"@ % @%"2@$"2@$`%12"  % `Nf %(&t % @+@%Ѐ %(@肙 '%f $W<@<%(@U9' ل$%(% @g 'O'ZZ<'L'($, %/%􀙏W< x؄$R<'L9' % @%@ $V$B%0%V$BV<"$\ %(  % @<`T9'  % %W<܄$n$'Z<%'L'oC,%( ,($`%e$LC$o$Cx$ C$Z| % 6@ $L}$ C`%(C`B@,@8 @ @C` C$by % @%0<%;$`~;$[bj@:%`  % W%@B$B,@/ % %@d %(@@Z<<}$,@%(8@ DDB|@D"B@<@($$@$<($_)+@#$$+@$ ('"$$W<@<%(@9'  ݄$)$b$= 8@W$#$,@8@ $$  % 5U/ % 1Vmi ('% | %@7@Z<$/ % $%8%( % ,@Z<mi ('% | %@#@Z<>$/ % R&$%0/ % $$$q&$bW<| %  @Z<$/ % $y % <`$a+@)$;$LW<| % @%(% ;$y $[ %  V/ % =U$?$=<|$r}$b{$.W<($H 8@ $b$)$%0%(} H'%@B,@$ b)$P  $%@P$ $$%@W$®H@!B$q % $q % %(('%0%( ('@Z< 8$@/ % ('<$b"$4B44%(χ % @$4$Cp4('$q % `$q % %0%( % q@$% | % k@$=Y/ % [$r % Y=$($ By@($,u@($8=@($pH,@o@B@ $ $/ % WV)$C% @| % /@Z<($}s ' $/ % VC$c,`{$C($C$ ($DC  %  $ CC$c,`($C% @=}$: / % 7}$=$Z<|$W<'Z<(LT0,$ 4%%$% $;$B%0@>%( } % %@B,#@$;$B$ "PV %/ % Z4@W40,($ 8'"$$+C`C$B@s `B@B@@' %`c$ ' @b,@c$ '`%b@b$b $C ZC2"$/ % @%@$7% %(a[ % @%(/ % @D%@<840,($ H'q % ($ {$'$}$%0%(@ % @%(%)$q % '$$/ % @P'$f %W'$%(@q %  \$$`$/ % @P"$V"$W\$q % / % @%(@% q ^$%(@ % @`$q % `$`$%0%(@ % @`$\$/ % @$C%(@"$'Z!86W<%(  $$%p % Q@$[Z<'L'L@$ec$d%0`Ȁ%( % @@%@Z<&$D@<840,($$H'Z$ec$0$$C`%0` $e$ g $$ gh@c$ɠc0$à$C0rd$CB0%b%be*$iD<%@pxt,$ % (tx@%8@@G$dHI$%4W&Z@%@L#Z$#S!"dB$!"cu*D`*C` $B@&% \&"* @tplhd`\XTPx';Џ4&R2%B% s2LHD@<l %b%  80<D8@?0?c0\HL,($ %( % @%( % %'Џ'Z<`LVZ<Žh B$%L'Tld\XPLH,ݯ#' #J@'%(͵ % ` &¯W 754 % | ¢ ¢#(gآϢ΢̢͢ˢʢɢȢ ¢%  ޢ עբ Ԣ%  #(Ch &W<(B$%8$< $8ȳ  % x  $\ % W<8B$ %8?$< $+ `<W< L$ c W< $W< $W< $W< $W< $W< $W< ,$W< p$W< $W< H$W< `$W< $W<4$\W< $˴ 'Z<L'$ @+" @@$BB0C$ %((8M@ %( $$ W %(W<&$  <T\W<0 $ \' W$@W<@<%(@@9' $ %(@ %  W$@W<@<%(@@9' $  % @ @W<@<%( @9' $  %  % ` @'Z<'L'l '$%  %(%0X@$W<@@ % (b+b@@B( @X W<%8`%0%(@ ,$(腙W<$%( % @(AB$@@V$\W<(E !$@\Wb$%(% % %@%  %( b$%(%  %@%H1o % @%@)%s&W<@! 45%(%%  % %( % LP%(*ba@@ FEBDBDA4!8D$ FDDT  %8$%  % `6FBDBDA4!8D$ FDD<% 'Z< Z<$"L'$Cs$b% @$  %C 3C704@b( <!(e#$@8!8!0+8!8%`% @1@%@ЂW<$쯥$ % @)@L<%b$`$o&!DECDFG*C%(G!d+ pvwA,`%0@$!(E%Ȁ% @!@8W<1B$BD% @<840,($H'$Z<'L'$L< $0,4%8q9'b%%@$ЂW<$1$ % @L< @$&`n9'% L<$P&4o9'% W<1c$ #40,8'$'Z<,L@%%'* y| x t p l h d ` \ X  '@ @%% B$ !(! D$c$! d&*@##8o*G`#0%8@#0%(B % #P #8*G@%8@#0%(% B $!h##Ps&J%##(o*(E' &P !(E!D JL%` !P!HB+4K+bB+KB+KB+KB+KB+KB+KB+KB+K B +K B +K B )I $+" $k$!h!`I@P@H!P !H B.N+NB.NNB.NNB.NNB.NN B .NN B .NL+B)I$+@$#(+@#0k%B$a% ' W<$%8 $'3&%X! OXY# (@"+]@jF%(%+0@$!<!#@!T@`&*B@%H!!pyŏ%0!(%% `#'d! @! % &ďD+!@%H@!RKb&A&b@k` '&!#b!0!D!"B!E!C!"B+8!B%8%(% +8D%% @+E@0% 0%%H%h%@%* 6@*-e!B#D @ !"G%gE%c$@(%!(%*8J%@@!8#8 H$ !"G)%P%$%bp!Xn%;%``*-@.'#M#8*G`#0G%8@#0G%(B % #@(#8 *@#0%8#0$%(@B % !(##($D$#0o#8*0%@%0%`%%0% %x#8E#0o*0 %8 %0@%`%%0%8%(%@ %x#0#HE*0 %0%@ %%0@%%%0%(% !Xb ! eh DXY%! OCG%,00%@0*0,$!(d$<e$1e$Ae!`e4 !eb4 c$4!b4 c$4!b4 c$4!b4 B$4!b0c$$CPL6&0F0!0&ƌ:&8P%4 !eb4c$44 !eb4c$4 4!eb4B$4H@<C$<GCDDHB$HHDg(  $#8#88%G!eDH<g$<bDDHB$HHDf($#0(%Ec$DH<f$<bDDHB$HHB(@<C$<GCDDHB$HHB$H'%8# ,0# 'd$d$%'FCc$B$j$`d$%*0B'%*(C%(4%%8'*00>@$@0!F!Jhb$B$hb\'B$$!(B$!0fƌ$!0 !0Ɛ!0dɐB$$@$@@B$!@F00!0dΌB$%$dά@%B$ '&@@$#M!0H$!ȤhF$$hF%B$HF%0'ZU"02 0?B$!B܏3@B!D0 % @?0 $Tď0 X¯XÏ܏"b"B?B$!BD2 0܏@$$CCB0!!W<FŎ9$@<@9' &!D0 gC$!c܏`$?0 % @Xď0 %@܏%%%*b @ !DW$B0B$$C@%%s&@%$"02 0$0܏ )100$W< 9$?E$(!(% @$ $?$R J1!$'(I ,%(* .h$B$)0 0܏@%X|`R&@W<@`W<%( 9$0ď`%%XW<%( 5$܏K@W % 9' !4|C$@!B|$> % @!$U( C! $!(%!!F!tbt+F`B$$!B0tbb2$> % |s&B(@&B$@!  Dt'T'@B$ ! $@ ! =(:@i @ 40,(%(@% $ !?8'” @|%`B$|@!C!t@c$$9'|`%R&B2@!"!(#!t@B$p!c#Ci`!p•!BB$*hb*h9'%`¥@h!h T%T*x%h#(!(EΕ!MN! `!`l!MN!$$! %Hb$%PJ%TE$@!TEVE9'$VETB$ T`@(T*!(@c$)%B$* $!D K# d  ! dCJ%$`$$$$!$FZE(!(eB$be@b0 @0bD$dd!bD$`b0@$fd# Y H@<840,($ C@'d$Ē!CDSA  CB D&&l&B B D&4$B &$% B %$B &“$B$!DB '#*@%( B % `%(  B % %(% `<840,($ @''Z<LP,($ 40$%4$j$!e@ % @% ! 40,($ $#(@C8' !P*D@&DB0 !Q@!bd0F@ ! dCXb.U@#f~B,R@~b,!`#%8`@%y$!m$ s.!h-XO`$$!(&!S&oB"Xbb$%@UUfB$##B*(E(!(%8@0@0!0fƔ+&@+'!(&+@%%$b#bB,@$,m@+k@$d$@ # %@B$#Cc$$!B@&CB0!Q@!0H@!hDB$@$ $@% ! #(@C %0$%NA 4UB$UB$UB$UB$U$zB$B$Ut+Mg`q#nB$%8@! @ % @@% ! %0@C #(B$B$c$%$'Z @$<%( ! (A <B$B,+@$A $C A ' A A ,($ %%0'n$$$DB$DB$B @NA d@&DB0c@&CB0'Z<@-Cc,;`#03“B0B4£%(`hF D&$bc&"d"&$!Ic$dB$QD$B$ $!H" 2@b2 $!b!b#3e3$s&c$ $!H#`$@$P&B,%@!b$B,!@D&“B0£#03%(`hF W& '̀%0%(@ 'g$ǣbh$"b"b"$%%@%!p%@%`c$dB$QD&!0C$!P+(P+(.#5Ѯ$LHD@<840,(P'%%@%#5Ѯ%+T@$$'Z$?%0'`P $@@<RR&%( P % #0%(%@ % V<%0`% %@ (J$#2%0%  %(%0%( %@ % 40,($ 8'Z<'L' '4,0$%(%(%%% @$ %d$%(` % @%80$`P |' %8$`P '$%8$`P '00<'00B$H00$0$ %0? $`P ' R<J9'S< &%(@ $%Ȁ !'$R<0J9' %(@%Ȁ $ A'4;1$&d$%( '@%8$%0P K${ @$0@8,%0`P L$$P %(@#`$4d#bĂD@$B0CV$%*$%b@<%(@9' p=$%40,($ 8'q(J$Z<'L'N<9', 40($%%.%%@B @4$40,($ 8'B0 CW<%(=$@<@9' $@$%C B, @ "3@@" % @@<M9'  D$ #D EЀDEC "%(@ D$#*b#%b(# b,#bW<%(=$CC C CB4/$."R@4$%8%0%(@Q % @%$b@<<8%g9' % ` % `8#2X%0 %($X@<R9' %0yV%@ $ %(@W@$ Scvs&b@V $ %(`@$<B0C@<%(P9' % A%@/%Z<'L'@<@Q9'48<'0, $  $ AV<@<,<9' $,@@< 8 @$ % `0@%@W< >$d% `\XTPLh'b-$C@f$p % `@C`f$CEW<@<U9' (>$B<',(8'$H& 8&& &@'Y$0$  $M$CMB$DC$% /$C+b`@E%Ƞ % `R&%@-$=9`N< B$(D@$@9' B Z$DC$DDC$DC$DD#w?!(V+!8!G@@+(%)%`#&!* b!% @+ pE$! x!bG$GB$! %8!E$E!"D'$%$B$%E! %@ %^R @+ BD!2$0" $,$(%  ! B$8!8'$%H*%(R@' 8($%%<, ,E%$1&K 2&EB$e!Bd&&%$($($!Cc$d0$$$%($$4'@'%d&b40 C8c$4$,($ 0'] % @$C(%  ,$8 B$,%Z<'L'N' $CW<,D$$ "XC\$C"@<"0$"M&%Ȁ$" R<~s&"%` %(@$/$ b%($bS<,9' 04/!C+b! !D04$%@ % 0Y>!0fƐ>>?B00%(Ec$&&%0%04 J'4*w0c$Z<'L' ,($%XW< d$@1&$@<@@Z<ER<4<9' % `%@$.%( % .@Z%(d  $d%( % `l % @@<%(@xP9' % ` % ` % @@&n@%'Z#H"&!@% $(`B2%<@<  $<c$@`%PB2@%(@,\W<%8lJF$ $ % ( % `_@%@%8@V<%H,08@ % %8@@<,W<\lJF$%(@M$ <0!8<@ % !H^ 1 <@HW$&F&e%+ $* e+@%* e+F@%4% 0,($ 8'Z<'L'$ ,ٜ (W<@ +Q+!V`%@<89' @<%(@`79' % % @%(%3%@@%@+@2  %( L@2@%0 \W< tO$4 %  &|%`xtplhd`\'%`%@2@$h % @2@Ă䂙W<D%0  Q$<@Q%R<% 9'd @% @d$ &`&s&UƏ%(, (( % `B&,!&D4%d %(& $%4%Z<'L'$ @%%&R<􀙏 @ % @&XP %R<9' %  &%R<$Z<'L'@< $$ %(z9' % %@B@W<@<%( Դ$@9' %$% (''@<+B8B,%%0%(ty9' !  'Z<'L' $"$%%C%'$C@4F5E$> FEB0%B0@%8`\(,%0  % @(,A!@<@<`T9' `XPHD@<840d\TLh'&D$F:F4F6F>"FxT9'  $@<'Z$` &Y$%0% %(%(`% $2%(&Y$' TPLHD@<840X'2%(%@ % `%(@((>D$'Z[$@<@9' CC % @Y<%( @$@X<@|˄$! %(T' %($$&$DT'$D%($ % 7@@<<9' % @%LHD@<840,(P'!+P!u%@1&!B !b %c$!F#B!!#s2 Vu$,%` % @,$(F %(@$.%0% B@ C$b@<$<9' $@<R&@$T%PLHD@<840X'1&%%E% $B%0$-$C+$$X2$t pptA &*@&W<@<@9' h^$|! !c&bX @$"2@6&.@6$64+C`$|W%(W< ^$4A@@x P%0x%(@ $xi@R@%'W<%0`$ % @0`30@ % @%0@307 % D$ %(@%($ % @1a%`30@" % "B4"'@% @# *@%@ŏ X% ((@ % ޏ$+%+(1 $%8%0%(@m % %@" %  @% @# *@  % @% B(@W< d$&v&X% % @%X % @1Z<'L'P<%0 ,($'ܪ9'%<@Z"F/EV<>"FEDDBDBDA4!8D$ FDD 'DD FBDBDA4!8D$ FDD<%C<D&(D>"FEDDBDBDA4!8D$ FDD#DD FBDBDA4!8D$ FDD% Z<'%0L'% $ %Ì`C Ì!bP%X%(  &@%$ ('Z<'L' ,($% %J@%@B$`C @< B,@MR&$CC$X`%LV$6' '0'0%( % %@%@‚<@ d(%8$ %(6@! *B0`$`$B$$1&%@ 0%0 %(0!^@$'*@ % $!@\% XTPLHD@<8`'d!B@$R&$4@ $%C`#P0B$$00d$0`C%@<4FEm `%X<R 1&$,mt %( pp&0($ 4,8'8 M % @@% %@% @ %( M % @@%@B@ % @S<9' % %@Z<'L'@X%plhd`\|xt %< 0Z xtplhd`\X%'%@xd@ @ $8!# T8% @B$EH <@%#T! $#TB$D$!pDP % P @x#0%( % @#T&$!8!(% @t <<B4!(dt %(@%%b%'$ % %# $$C !$%C @&b&$1&% %@% %.$bb& B,@<$4HgT$$d& $%HI$_ $ b6B$B,@_$bY<&=_$' .$Y<$ r@<&@$1"@%040, %( %  ,04@$' @!($ B, @ 4B$B,@%J&!&$ B,@ 4B$B,@ <$B<D % %@($.D<[$+D<&(<&<\XTPLHD@<8`''Z<LQZ<#L'b$+,($ "@b+@%%$#b+@r"C`D$B7D,($ 0'Y< џ$ B0S% %  % @D  B0@ % & % #'6FEBDBDA4!8D$ FDDB % @:FBDBDA4!8D$ FDD<%C %  % D!F(@4DM %@ % DA!FF % 0@4D@A0404P<&CPTT0 % BDBDA4!8D$ FDD !Y<$ 4Qk2e B *Q@@ %  @!Q"&QY!"2$CV<0DM @V<@<%0@%(U9' $q%(@lJB$ % %0p@%8   D,!F % DDd@%  s& b. @ FW<(fB$!Sb@ F2$C%DD %  0 F FDD2p FEY F$DD2"F$.8 'Z F #EBDBDA4!8D$ FDD0%(@% `  !4* ã%@%W< f$'4FBDBDA4!8D$ FDD<%0M % @F %(@s$M % @ % @ %@0%  !(%@ %0`%(@! P % @!0%0@%(` %  ! %  % @<&PM9' % !Phd`\XTPLHD@lp'Z!@'ēe 4#>R<'B$0Zd,-$&b.$b/`W<tl$P%c$Hd%( dd, a$b&! Dd$>df$dBB0<@W<k$@<@9'q$odrd,l$abp$fbk$bW<%` % Cd$,BL@c$W<j$s$dsd,}w$hdz$d-$BDC.$C%0>$ % % %(  % L'%` % %@BD@ %(W<(k$\ W<0k$  % @> D,% % Q&0% @ %@@%@@<%(@@N9' % $¯ $GD%  '  $'$B$% %8@$  ! %8@% $  $ B$%` @ $¯%$!( !(@8  z$ŏ!( $ď!(! B$B,@W<.œ,n$p$ DqD,i$DW<6w$DD&}$DW<m$Z<'L'@$ @%@W< lo$% '''Y[$X<[B$$ уMd ('@@<<9' &$ £‹›B$«»%(%` M&«% @%Ȁ  »@<% @B9' %@ «»@8 %  LH4 % $ @< ċlě xP& ѫѻW<%` x$%(@% %@ % ċ ě%  ċ ě   ‹|›@DDDDBZ$0 %@F0,' A 0',0%8$+ 0. $,%@. 0%(@% @"/ ,%@@. % ) "0  $C%0k+ %( S%0. R&0% k+ &0ST"*@%0$4 $0 Z[$@<@9' E$8&B"@%` $`@<M9'  W< %d& &$rn@W$ $$V%%@D$0D,B\$>D'$5D"$6DB$4"W&'$ W`W F'EBDBDA4!8D$ FDDXW<8 Xz$@V<<V W<7|$!W % 1&Z<'L'@<`T9'0,($ 4 %%$ $ $ $d % R S4y:0,($ B,8'C0tu B4P0Z^%   "2@"2`*b@"2%%|xtp' @%( ^ % %`"2@"2,@4B0 CRW$C%( ^ % 40C@V%  A%@R&@,%($ 0'3%0 ܀$U% '<@D ''Z@d % Z@@$! E%0@*(R%0@ӏ%8` $4@$0 % `@%ȠD $4>! 0%( %0@04/!P+! !D@(,<`04(,%`X# #B,@ @ @$B%0 ЂD % `@%@R&R2R.@$ $B$ % $ $!"'+(Q! ! $04% !Q R\( \ Z'Z<(@O$B $@@<B@1$H%9'  $pe&% ,G&DF $AV,F'L'B4,($(EV<@A<` F E'BDBDA4!8D$` FDV  !H%%&!H%b1%``%%%!Xs!PR!!H)!PɬTˬXì\ʬ`¬'%8@%X %P`&(%($($%( %%!!cB&b!d& D%!B&@ %D% ! b''%(<840,($ %0@$%@%xČp $&%$@ $8BDT%H@C%@ &H&C$㌂T!h!C@F%hC%@ &h &d!C$@$PTX\`dhlV<%% %P`%`%%%0 %8% %$%@²%&B%W&'$l$&!V!֎!VR&!V!S%vB%w&%w&&$d$&w!%!T!S%U%@<!"! !p!8'!0!!Xl!H*840,($ PTX\`dhl@'%P%0%``%8%% @H'Z%X% !LKJ'H $H+C&H*'( I$( I&(E'( $('$j&i'0 &( C$0$E&0e0F B$ $),@cV$G%C&W$&CR&G^s&'% `H'?B0Z<%$L'D$$!Q<(, %C@$0qs&#%0@%(!  R.@HLB(%(e %`|% @%(`8<@ % @% ,($ 0'(',HL'Q< $048<@D%P$$%@@0q9'ČŌ $%$HHCMLO!tFpB!x+@h!@@D%@{D%xBo@%@Bo&@%h~%&h  DE1&h!hm&@!@H+B!h%xGB%@6%6%0&0)@F&%(!&E!&0+hM!0fB!0%P$FR&V<%@'$!!HedCB!! +(e!(4#%p$%h3$%4#% & &0Bj%huB%N&0!0f& 'h! +$''($h!d&h$ $(!h&(+0!(e!(!0+!(w!E%pni'(%x%d%h@&)&h&%(@v!&x% &(e&p*$x$& $p$hI&&p!+ d!p!p!!h+! D+0f!pN%!D!pM!!pN+ d!S!u+b!U $!W!Pj+!J$(,!V!Hi+!I,04!hM!r+!R48<!Q!t+"!T<@D!8G!`l+!LDHL!^+!Xk!p!K (0 8@HL'%%X%8 %`%%H@%`%P%%@%`?%Eg<#B$P%|$C,%($ 0'0 @%S<9',($  0' `@<0M9'V<T$V<$'0$0$+0Z<$)@S$%$@&脙% %0  %(+ sc+R@%1&5%<840,($ @'Z$ecB$&0f,!0%(z % $@d$ $$'Z('c$Z<'L',$40($ %  AS>% M>% ' BCbB0@W<p'@:$C% @$p :$@@<D$B @M9'1&􀙏5x؄$%@M9'  @<% M9' %@4&$"p:$ % @@%@B$;`s&&@<#(2@N9' % @C%@~$b/$T& B0D @<`79' %(@% =%@%@% X'p/$ % @A<@% @L9' %@@tD%`G%C`U$C.$ dDSBM@%(@ % F@ %('d%(% @ %@@%( % E$PMY$ % % @Ѐ%( %@0@$B0D$ bT % @k=% !0/$  % 삙3% @3% &@<Z`V<- ?'$+"@$5+6@$ @B$!DVH% W< $$@<$B9' % @@93%yJ%&&_$,&8&&#3!!@c@H c$H!'!!c%x!@ 93H"'!!ș%x@08H#'!%x&kW%X@)% FSIc0^3!@B0!!@J1)1X 00!P !H !X !0!  ! b !%8 b %%8 %8 B%8 -b%8%@ 1b Ō%@ =%8%@ %B %@ )"%8%@ 5Œ*%@ 9$& %@<,%( $&* $&4% 0,$ (8'@B0b+!0_%`Z@[$#:bR$^6"B$B0 B,/@ '%(`0$&  $ %8@;$0!B$B0 B,@%(`0 $ $ c0~  @%4+d`<% C $%dVR&*V@$W0Z<'L' $%$#+@% $%0 ! $"$!0 (''Z$"` ̃%( RI% V<@<%(,<9' $$X<Z&"&s&cB$`Cs&Z?%0@%@LH d,%(%(@!C)$2$ $ $% @I$$$& l% dhp' GH $$ $& E,B$$J F$#Xd+0%(!(,@%$$g,FB!$c$ ?$C%(e$B$?0%0f)f,$%0$@h0$c0!($$ Ee,$$$F$H(?0!B$^Z<'L',($ <840%%%%.@'s&v% ^ %(%@+@%0 %( % @ !T#s&h% @^ %( !B<#0840,($ @'#'%`%P$%X'$`#K| % n%(@$$('%`#Kk% %$$ c,`$$,$B4''8@< PM&HD@<40,(L%%%%%%%P$?$$ | %( %@(@ $C&& &$ % @! P^ %P@1&!%s2 `@!%@V<c$+Cr@D0ǐ@4ǔAD F@AĽ FD0ǰ@DA4x$!f Fbc"FBDBDA4!8D$ FDDDDB!FC0ǂ"F4D!"FBC"F "F040D4 F@AD0 FHID(FH&FID(FH&FID(FH&FID(FH&F0I4D0 F1 F@ F0 F"F@Ā$FA F0b4ȇ~ F[00D4D%0`DhD%<4D$D FE<+C`<+C@D@A` F $84<8'D8p@<tA FpDxDć  8<+C @8< F8<  '( B0$,$ C @$D   ć DD8<&C<<@''!<$0D %`,F` F@%<4$ D%  @%  F F $q@%(<$0Gq$# #00%$<4$D<% D0@7@! @!DC0!D@$ <%(%8!H*PI@!8$#I!(O@%!"@B  $% %` <*@!P,GG+@j !`IA%@'@ G!@#G+8j#G#j! %8G!@k%!@`BH %C@D@ADpBtC"F>$FE$$% C8?<0!8B <% -!w$@@$"F<"FE$&B,!($$$ <$'!' ̇\&% '@%mC$/$!E/$E#P!/$E #P!@ `c$!B$B$D(J&%<#'!'ЇĂ,($ %% %PN%% ԇO%@%(Q% @m% @%8$%(@T% @@%8%0 $T% `"%(؇U $,($ % ܇S0'9'(B2@lxB%B |% (0'%( p'vp(\'<䁙%8 $$Oz% `(lT"B0@}(l@̇̇c$ _$ l9'lx$&;m%(<840,($@'X<'!l0tB'bB040,($$@$$!@%%'$m%l5lxd&%0@|%( 0?9'q% Plxd&l%(40,($8'<'!'00'$4$('<'!$ #Tb% @<`'!z$ #TV% @<0'!:$ #TJ% @<'!'0(d`$2$r %C@D<84,X@< $DC@<840,($H'B4+@% $0%%@%  %B%8%0%(` r$$ C`12$#$D@<840,(T% @H'<'!<'B4+<840,@0 $C$<840,@'%%%% `% {P' P%8%0`%(@G$ T% @<'!;$ #T% @B$3C,6`!bC,@@8!0@0$0)>!8B$%8$$8$%b`$B$@F,%C@$c$@e,%C$X$C$ $ $<&x $%(b%  &p<& > $"" $hxB$h&hUl|&!Cl1& Ė{$"%( $& _ Ėj""$8%( (&!P%XRV%@T$<0'!'PlLHD@<8 T40%%%?$('"$ďQ@ 2&% @ %@@¯$C%TPLHD@<840X'1& &%8%0%( %  S%@`%<'!' $ hd`\XTPLH(l%%%%,048<@($$ $<$C$$%(0' Z_'2 &$#g+r5`"$#'B$C$Q$ R&%0%(% #VQB_! @!060F@%8@%(('$ C)@$C "$$$$$$%(,'b$lhd`\XTPLHp'$b $$bBc <'! $<'!'<lPLHD@ T84%%?$('"$Dt@ 3&4% ` %@@B)$C%TPLHD@<84X'1& $&%0%( %  T%@`%B<'!x'l`'$|xtpd`h%@%%%%0%8%(`  ',A%@$* @ &.$®M$$$$®$|xtplhd`'ޮ $$C®B $$$ &c$w% #{b3% `ub%@'!r!b!v+C`"$! &('!%-!V@Ѐ%(`P% aRbX%( a%@!@d&Ѐ! da%( D=b@T% !CP!%(^% &'%@`<'!'$ $ % $$$ ('$$8+b`% Ť%(]%0@0b$␀$B0 C$ $i$c0h<¬<'!'$TPLHD@<840Ob $!0$$#B, @%ib'B$$H!bB$D%%E$W$%@>$#$b7&" >&"h&t&&& &"!"#^B,<@$ @?B0!BCP@B@PB@P P?b0B$!S`%TPLHD@<840X'bb%s—Ɨ4CC, `$$C—$B$$C! C$C' $0]% $,@' %]% `$,@'#" $ $(+],& $,@'#" $hlps]% bb| & &Ws&h&"!"#WB,0@$ v@"6%@B,&D& $(@,$12Ø '%0`$^% $b$12#Q$!Qq|$%8%0%(W9'% K!CC, `$$C&$B$$C!1C$C&"$% "$%`%0&  @%( $$\% $$%(^% "%&B$%0% %`$,@& &v\% % %<'!'%  '<4'!','40$%(%F^% % |(%8X$ %(@$40,8'؄  <'!' $ $%8 $,%8 $@$ %('<0'!'h($dX|xtpl`\% $D$J$,$F$<$I'(%K@G@b28@L<0$0'8'>ܙ$(@%@$H $%(@[@'(4'D $0$[% (H'PD8'0B$TP$,$DЂ% @ $[0$(@'<&&$.$bF0!0!EƐBc$$hDЀ8r$%_'(<4I$(p^% (@ $C@%$ ^&&B$4P%0%((@$h%0$@% (@#$BB,@& ' $%(S[,'(T $M[% (ЂH$2[%((@"& $@%0CB$B,@$€$D`B$B,@#0(k@$ "[8'(8^=% (8\@c2L @`$$8' $$'%  (0'<$%0%(@% ( @8|@8'^$%(@ % (85@c2=`$8'$%0%(@o% () b2@$##' $$ B$0c$ CB+C$B$B0C1'DN% (@%$CE$]% (8'^% (+C@$|xtplhd`\X'C$BB0Ѐ,^%( (`%` %@b2(M@8<0$0'8'i=虄$~2(B@%@<<8'& $ $h%0`$?% @(/@#$po]% @(@%@V@b@DWq$` $4'Y% (P4$$%(&^(@#02!(@%(@ FZ8'(8<% `(8 @8'##' $` 1&0B$"S^% (+Ct@Ѐ]%( o%B$B,@% $$<0'!'%8 ,%0%( K$ ,T% @0'<'!' 'l(lH$,$ &@&%,(%`0'@$% !D5@$%@Ă%  # 4 %0%(@! Dp@$D&l$< ʜ'!'0j(,($@9@$%$)%@$%($.$,$ # c$! $ %S$%$$ # c$! $$,$ '%8 %% % @%,($0'|~9'% @ЀV%( <Ȝ'!0'%%%%t$W% C$c,`F$$%' %(`R% "2@ $B1&]`%0@#2;` $ B$ B$%%#C!u$ $@@ @@@@C"2 @%12 %D&%$P& $*@$B%% $B$$B$$$ B $#C!u$ $C$@@@ @@@C4%(`% y@%@"2@%8@|%0`%(9'E% m@%@d ' '$%(~% n@$% `%)@#|+b`!uC.$b. .[@$ %0%(`)R% !!.$b|zB$&|{B$ƒ=@%(.B8B,!b$ @$$%ă @$##U+@%0 Q! !!b`%8@%0%( % @%@C%'|%8@@%0`%({9'% %@1@%@@$* 0B$D&&*(@#t! $b V7& # $%(`Q! %&s&% % $"V$ 3&%(`Q%  $ %(Q% `>&1&'[$&|| ~B$D {b&%P& $ $"" $8"$(,04 zC('$%( % hQ % %  %8@%@A%0d% V%($ ' W$$%(aL'5$§ק&'&%(QL'5$ $§$¯ $§Xt $V'V%( $G$ 0-N%($`C XB$%@%%@#T@#P!b''%#w+D@#~+T @%@ *>@%`Ԃ#0!0*$]@ %@L'$)$% $'D%$`& $C$ %(K& $ %(K&'&"@%)%J%k%xfEU% '@$%%`)%$2B$@!@C$%8% @%8@(@%P`%H Ђ% @aK%0@@J%% !C*(EːjƐ$$ !PE$0$%G !C*&@c$b@&`c$x!bf@$!bE #I!b%  !bDK%0x$pU'%<$'!P'd(' %%%%0%(9%  @$T%0`%(@% %@%`'c$$b$+8E,!G(&$B0F,"J'B0@b$+0E !0ƀ!0b$!0%@+e@€@ˀ g Hc$c$!B@[$c$c$$%@[$f$?$}f$%!Qv$s[$! nc$C"@% %hf܏Z%@܏=R$7B $+B%(@'@d '"% ܏ @%(@8@$B0C%8`X0ď%0`<9'?%( +%ߏ%  '@% ̇\Є$,ُ % @2$%#@%8`%W¯'¯X@% 0,Ǐُ%0 %(@܏-@%@% ݏtŏ@B0@$C4C@.$C`bF4$ % ܏@ݏ}Ïw$2 G4;0@8,0ďFُ$!0 %(܏@S% $d8'!% PǏ0XC% ܏}<~'!'%  '!%('XT % @j@$^Q SD B0@`*>@ȈV% %'g@% V%%@#(S!*>R@%`TX @@&$TVC[$d.$d=$d:$d&%:$$!B@C1&1& 8'% `%0 r8%( '!% `U@@%@N$$!J$!C]$b'& !%$@C(`C$: $B$!$(S%\V% S\'̈U@V% %@%#S!(~*>@%\V% \E'p% XB0(' @`1&% % @@ $CC$CXD0,T$5$% % @@<CC$C$@B$Ĉ%8%0$%(@%@$ 0('7% @$!b@,!bF @ÌŒ* #B$*"`%@&c$Ѭì%@¬Ӭ%Ȁ%(%(@%Ƞ0%0@@%@ $$<['!'$ <840,( %?$%mEg0@E(q,D(J*C(d`@$$LC臙$%(  '%@@$ XB0\@4R&̈$$  $+y(@B$!b$$@$X49'W$q&@ $ %{$E|$CX$$49'B$$$$$#{$+b1&$%0%@1 <@\%P#B$X @%@d $(@c$$$$@C0 S8`C0<` $L`C0 $FDB`C0 ` 6` $P8`B07@ B0H@@B0[@B0@<"@ @$؈E% + $؈EHH+ bdD`B0} &؈E% @ ؈E@ ؈E@؈E% @<@ @$؈E% + C8$؈EHH+bŽ^@%8Ĉ $4%0%(@%8Ԉ4`J% `0@A% @o:% i $V@H(Ĉ4%0%(H@bî%`<% `®@®® ® ®%(*C`0\`bX@Ď!<c$D%@Î!feB$$<!bC8B$88BA,(qB$e$c$(*(E,g(%"@"B0~@$880X$0'%8 0!X#%0',! DA@ #!&b!! 臙$%( '!@%@@$!H"O@H"@8@H Q,*W@,( @,X (%8@"9'%0`,@% `VxQ"B0@ B!@BW^% ` %(*C1`(C!ecB$$ "+_@"+VZ@" @C0H@"H"L8`C0 $L`C0 $AD=`C0 ` 1` $P3`B02@_$" B0C@_$"@B0V@"B0o@"B0@"B0@"B0@8$`0 %( @dD`B0J 1&؈D% @_$ ؈C@ _$؈C@؈C% @ @_$$؈C% + _$C8$؈Cdd+b @_$$؈C% + _$$؈Cdd+bv8B0v@%C% @m8B0m@'E% %C% @`@ E% %C% @i@QB9@%8Ĉ $4%0%(@%8R@d(Ĉ4%0%(d@bC%`"WB "^ B % `B%(*C`0#5`b1@D!Wc$%@C!feB$$8c$!b8W8BAk%,>A @T ,4 $1%/$(@%(4$@!d +s` $% @B%@,0!CD%@<840,H' A B4$b"#$+(#B#D1&s&$! $$##%<'!'00'$4 $('<'!'L%`%T$$d@%  T ' '̇tUs&DD2 FE4<s&p FEDDDD4!8D$ FDDD&A!F6FDD F8F2:FDDE%P%@B&x $`C ;%Ȁ !#A%(%Ȁ % @s&s&<4'!'$ ,($ ( E#!(',(%`bhc$!H!Fb+E@#ppB$p%B$%%$+"0@'pl&%8@%0%(%D%  pB$pTB$p$YXVT@,($  0'$B0D&%8%0%(%   $pT9'G% @ &!0B4#!bB+U@%8%8@%0%(l'% $$ % @ %%0%( % $%( % @ $*$ % @%@%(@% @ !%!"H$%% @8&$ % @ ! d&! %8@%0%(# $%$% % @c4%8@%0%(%! "<'!@''%%$% %%($| d%0%8% C-D%(`% %$ #C'!C+b! @!D%b@!P'<'!p9'$<|'!8'%%% $L$ .% %eB$E%B$B$B$<_'!' $'%l%4% %(@!$@%(@0% !C `("( %$ ('@$C$ %(#('l(0%$ ( ('<^'!' $%&%%4% %(@!"@%(@0% !#b@% $ ('b$"`$% ('Ќ%$ ('aC0$f`%`$$$ $%X 0 $l%Pi%`$%S`$b$ B,@%X $i%`!G0$*!G0$%! B$ B,@!8B$ B, @$0$B$ B,@$B$ B,@$!(B$ B,@#i@+0fb$ D,$% ,0B0#D$$F%H` $%@%X%00$<\['!' ,($%C,`B$ %$C,%@($ 0'̇Ђ!B$P%&e% @d$$2% $ % @@s&` $P%&a% % BT<,Z'!%02%(<Z'!0'i%C, `B$ $C! ̇Ђ!"$P$% @d$'s2% %(`d% @R& C$b% '@  $CB0$%!0bƀ Gc$! !b!fB$%b%b%b'!'0hlLD@<4,(H8%HD&%%`d%p9'vlGY,$lKl&8gI+8$#(+(l%0p|%h%Pd9'$-V@Bp $@!&pd9'A% `%`@$r:d%%X@  "@ ! @ /! %P@ #P*+*##b*l@s$+PKq@+(El$xB%(#H`C %M%(@!E@!@@$q@ԉB@<ԅB#!`ЉByb!x! ~"%`@'! d%@  !/B@ ! @ ! %P@ #*+ ###D* L+~#p%0%h%@g%Xg dc$$bg@ @! !g@ @! !c$+(E!8&!"B@@ !b! @ @!!@d!0&Ő%0@@|!(E@(!(p% d9'®lxB!C`b@ ! @ ! bLHD@<84,(HD&0P'%0%(%8X4%  %(FG$+%!C؉% %0%(* fp+"c@&&+؉!~% %0%(* pZ+QV@plL 9'%($6  l%($ %@* ԅ/! +8%l!0焌!0/! D+8!e%!* * .f* + +* * * +> p+"@$®lB#`ԅB#bЉB&+T'%@!~%p+"@$*@$+> ®lB#b<|7'!'l:H&p9'H&T '<7'!' l$(H$&p9'ȉЉCBlB@llxDtc##d+C @H$&$% ('DlJ&<6'!$'+D$!e,40($#`%B, @$0@c$$¬<$3B$@%,N@$!e@!ic$&?  E(`d$#b%&s&%@<'!'p' $%P% $ ('$ #<'!'0m<'!$ #T % @<'!$ #T % @''%0 % $ +!C' % DDxph`\XTPLHD@<8|tld'% )&11 R&!bWB* !hu2%@'%`~1v$b$B0(!b!(eD%`%C.$,FDD Fh+ DC$B0$CC0$h%%'+0~&+(DI$%` !BT$$^  % T$h@'#C0!CC(3`C@,D!F``F<'c$!C"FRDFl"F$<#Qc$!CFF%(; <ʌ5 % `%X`%c$$F 8!E(c@g%c$0R&$!bE&#PQ R%%`p4lN9'% @ FE:&%%@B$D@A Fs&4B$*S @DD2 FE "$C@ ,D8b4F&@X+P E$"Fg%$F%! H &@84F%! H &+p!D#s+sB$#C @( b5"* +b`5"*# 1& 5"*@T$DDDFD4F!Fc6Fc Fc4Fc FDD2` FEǐLjǀ|xtplhd`\ǔnjDŽ%0PXt 'h[@C$XC$B$DDD!FM"F`%0`%bp$8d$b,5@[p$,% ,0$h+CB`C$B0$8C0$h%0%$+`CK$+P &B%0! GE% $ $80,% 0&$+8f8%0`!,E%`h| %0%8%  b,@%0%^ $0,% 0,0$!@   DD8b!F@d$Xp$<ל'!'h%,@TPLHD<840l@$%%%h $R+@$% hRC$c,`+$C-$C%c0$$]0$< 5%!H#+wb` $< 5%&$wq`<%qR&!^+@+2`7+SD$`!B!^+@+2%B!^+$$%0@%8 + rC+QW$' 7!!Ce+"!C+ SE$B% h!C< c$!Cc c,.`<`B$|%0%8%  $C%%TPLHD@<840X'-V8.+s@#b$bf<%R6!qD$@ ,+02!b<q$+S}`D$B!qD$@ ,+02!b<7<%'6 ,}`+^r`nU+7G0!(q%0+!0!fG@7%'@+H@(_ 'PXh!+(%!f+ SD!C$BD$% !B+W@h+S`D$B!B+W@ "$c0|`Dh%@%B$+T/@&#6&+"#Vl#% h!}% hD$u% ho`< 5%!B B,@`+T+"@B0@+$+@T+Q@& "$C$%C+S`C$B C4x$d$< 5%!B$%% hh@%@!w#w!BBc0D%p$!d~<b!B+W+ 2`0 3%F+s@d$% h! 34%$ (%0'(%%Q+s@b$b!B+Ws`+#`"FB%r%Q+s@$ % h$ !$'@$( % (%0(+q`< 5%!cc,`&o $G@W+ N% hZ C4+S0`C$B< 5%!BC,`4`( C$B$%W%+PE@ &$+d"$D%`E!$N$$V% h|%0%86% %,%( <̜'! F'ED&HL"FDDDD4!8D FDDF$F! "FBDBDA4!8D$ FD"& ! ! BDBDA4!8D$ FD% !@ !@8D!8F F!8$F$!@ !@$$F%"F*@g*@g@k%%*:HcLǸǰǨǠǜB2|xǼǴǬǤ'$%@@! %8o$%8@(x$%@%HD(讼 % @HL>8HL<+ -$<+DD F4D0,D8' ?<+i@@B$3C,`!bC$@$$FH !@ )%%@  $$@ $%%`B$#@%@-$$$B,<'!'l%8$ $' '<ܧ'!p %0%'$'@C(`!H$!H%%P%X$#x$$.$*@oh$`l$Bl?1A%@ c$#f*`!k%G%@H%Pl$c#h*hm%P`#h(*hm%p%hJ%Y%%!P!ё%A@c$#f%+e@$f#db$,b$+(E$#db$%@ (@$B0@%'LHD@<840,(!h!!@tA)' $$ $ $ $!Hc$j#@D$%%%%$$!!H&3%H%-B$#@D*@H -$LHD@<840,(P' +h"M+h"+@%!HCc$c,`B$#S*u`P.`+D$+`+&!P !"!+"@$%8  &%   @ "&$ !! #%0% ! #'%% %(%0! #'@*& ,:@<5'! h<$D4$G/@$,$@&!h' $D$G@$$@$$&% %(% '@$0$@& <|'!'% %&@% ' '! ' @%B$C`B$B$#D%<'!'p$'%((%,% ,!(!&(&&% 0C0B0Ac$@!b$B),% $(0'<'!'( 40,$%%%C,`C$ $C$40,($ 8'+p`#Ṗ&Ђ!p$P&J% @<%b#2A$|#0%  %(`*1@#$# $+$#(E#(9%@7@:$&c$$@, <& X$C $$ &$@,&&$1&$c$$$>$3, ! *&$@,!% .&$@,!&%% <}'! $, @$$ ''%%0;|cc`,< c$!B,@ X$C$ `$%dà?0$%C $4+`< d$! ,!$%dà$?c0?B0%D%d à$<+d`$%dà$?c0%dà?c0?0%D%d à$<{'!%'L $@%b+b@%0$%( % +`#0$(? % $ ('??AAư>OuA.A{Gz??>@@@ ?@Ơ@ @eA@@?p= @@Mb@AmB"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl=-DT! @-DT! -DT!?-DT!?-DT!!3|@!3|-DT!\3&<pG?9B.@Ҽz+#Q0-I+eG?B.?vkA>,%jV?lf?>UUUUU?@PCDR>?˖dF?Y"$I?UUUUU?x ?xq??CL>@???u<7~Yn`G?D] T>UUUUUU?@CNEJ(~?eɓJ?A`t?M&QUU?o۶m?33333?@ ?: ?[/>+eG<C.?9B.?9l a\ `p8@C0@A??8ı!>RO~>>wQlV?LUUUUU?@T!?1cba=@T! @1cba=0|@@T!@1cba=m0_?8C`a=sp.;.;I %{9pA@!?-Dt>F<`Qx;9@ %z8"6i5p>|Z:=+Z>}W>a*??IUUUUU?IUUUUUſe/"+z<\3& %s [%s] netmask %s No match found in %u entries inetA:p:H:t:i:adnDsvaddress family%s: unknown %shardware type%s: kernel only supports 'inet'%s: %s without ARP supportneed host nameneed hardware addresscan't get HW-Address for '%s'protocol type mismatchinvalid hardware addressfeature ATF_DONTPUB is not supportedfeature ATF_MAGIC is not supported255.255.255.255SIOCSARPNo ARP entry for %s SIOCDARP(priv)SIOCDARP(pub)<CHCTC\CdCCCC$C0C8CLCXCxCCCSent %u probe(s) (%u broadcast(s)) Received %u response(s) (%u request(s), %u broadcast(s)) UniBroadeth0interface %s %%sSIOCGIFFLAGSis downis not ARPableinvalid source address %sSO_DONTROUTEsetsockopt(%s)no IP address configuredis not ARPable (no ll address)ARPING %s from %s %s recvfrom%scast re%s from %s [%02x:%02x:%02x:%02x:%02x:%02x] [%02x:%02x:%02x:%02x:%02x:%02x] %u.%03ums UNSOLICITED?%.16s/bridge/bridge_idbridge name bridge id STP enabled interfaces%s stp_statebrif %s %.16s/%s/sys/class/netbridge %s does not existbridge %sbridge/stp_statetimespecbridge/priorityiface %sopcode != 0class != 1type is !REQ_A and !REQ_PTRname is not founddropping querysending error reply/etc/dnsd.confvsi:c:t:p:derror at line %u, skippingname:%s, ip:%s.%u.%u.%u.%uaccepting UDP packets on %spacket size %d, ignoredgot UDP packetpacket has 0 queries, ignoredresponse packet, ignoredreturning positive reply%s, %s%2x:%2x:%2x:%2x:%2x:%2x%u.%u.%u.%ucan't read Wake-On-LAN passSIOCGIFHWADDR on %s failedSO_BROADCASTSIOCGIFINDEX421 Timeout 213 %llu 213 %04u%02u%02u%02u%02u%02u 425 Use PORT/PASV first -lA-1Aftpd213-File status: Directory listing Ok to send data FILE: uniq.XXXXXXOperation successful Error %s[%u]331 Specify password anonymous530 Login failed 530 Login with USER+PASS 215 UNIX Type: L8 -Features: EPSV PASV REST STREAM MDTM SIZE Ok211-Server status: TYPE: BINARY 211 Ok 227 PASV ok (%s,%u,%u) 229 EPSV ok (|||%u|) Opening BINARY connection for %s (%llu bytes)503 Use RNFR first 500 Unknown command unexpected server response%s%s: %s%s %s cmd %s %sEOFEPSVPASVstatREST %lluRETRSTORftptcpConnecting to %s (%s) r+PASSTYPE IsethostnamedfisF:vhttp:///%s%.*sconfig error '%s' in '%s'closedStatus: %s.gztext/htmlresponse:%uHTTP/1.0 %u %s Date: %s Connection: close Content-type: %s WWW-Authenticate: Basic realm="%.999s" Location: %s/%s%s Content-Range: bytes %llu-%llu/%llu Accept-Ranges: bytes Last-Modified: %s Content-Length: %llu Content-Encoding: gzip %u %s

%u %s

%s PATH_INFOREQUEST_METHODREQUEST_URI%s=%s?%sSCRIPT_NAMESCRIPT_FILENAMEQUERY_STRINGSERVER_SOFTWARE=busybox httpd/1.31.0SERVER_PROTOCOL=HTTP/1.0GATEWAY_INTERFACE=CGI/1.1REMOTE_ADDRREMOTE_PORTCONTENT_LENGTH=%uREMOTE_USERAUTH_TYPE=BasicPOSTHTTP_%.*s=%s/cgi-bin/index.cgiconnectedproxy:%s%s %s%s %s url:%scgi-bin/Content-Length:Authorization:BasicRange:bytes=Accept-Encoding:gzipWeb Server Authentication&#%u;setgroupsOKPartial ContentRequest TimeoutNo request appeared within 60 secondsNot ImplementedThe requested method is not recognizedUnauthorizedNot FoundThe requested URL was not foundBad RequestUnsupported methodForbiddenInternal Server ErrorEntity Too Largebad: '%s'defaultinvalid hw-addr %sSIOCGIFMAPSIOC%sSIOCSIFFLAGSmetricmtutxqueuelendstaddrnetmaskhwpointopointkeepaliveoutfillmem_startio_addrirqadddelarptrailerspromiscmulticastallmultidynamicSIFMETRICSIFDSTADDRSIFNETMASKSIFBRDADDRSKEEPALIVESOUTFILLSIFMAPSIFADDRDIFADDR%s: can't downifenslave%s: SIOCETHTOOL error%s is already a slave%s: can't clear address%s: can't set MTU%s: can't set hw address%s: can't up%s: can't set addresscdfa%s: can't get settings%s is not a master%s is not up%s: can't get flags%s is not a slavemaster %s, slave %s: can't change activeflagsskipping %s: can't get %scan't release %s from %scan't enslave %s to %sSIOCGIWAPSIOCDEVPRIVATESIOCDEVPRIVATE+1SIOCGMIIPHYSIOCGMIIREGETHTOOL_GLINKnetlink: recvnetlink packet too small or truncatedgetting interface flagsupping interfacesetting interface flagsusing %s detection modecan't detect link statusexecuting '%s %s %s'IFPLUGD_PREVIOUSIFPLUGD_CURRENTexit code: %dexistsdoesn't exist, waitingdis/etc/ifplugd/ifplugd.action+ansfFi:r:It:+u:+d:+m:pqlx:Mkifplugd(%s)/var/run/ifplugd.%s.piddaemon already runningunknown API mode '%s'started: %sinterface %slink is %spollinterface %sappearedSIOCETHTOOLwireless extensionIFF_RUNNINGIF_%s=%sIFACEADDRFAMMODEPHASErun-parts /etc/network/if-%s.dpre-downstoppost-downpre-uppost-up ifacehwaddressbnmaskip link set %iface% downip addr add ::1 dev %iface%ip link set %iface% upip addr add %address%/%netmask% dev %iface%[[ label %label%]]ip link set[[ mtu %mtu%]][[ addr %hwaddress%]] %iface% up[[ip route add ::/0 via %gateway% dev %iface%]][[ metric %metric%]]ip tunnel del %iface%ip tunnel add %iface% mode sit remote %endpoint%[[ local %local%]][[ ttl %ttl%]]ip addr add %address%/%netmask% dev %iface%[[ip route add ::/0 via %gateway% dev %iface%]]ip addr flush dev %iface%ip addr add 127.0.0.1/8 dev %iface%ip link set[[ addr %hwaddress%]] %iface% upudhcpc -R -n -p /var/run/udhcpc.%iface%.pid -i %iface%[[ -x hostname:%hostname%]][[ -c %client%]][[ -s %script%]][[ %udhcpc_opts%]]bootpc[[ --bootfile %bootfile%]] --dev %iface%[[ --server %server%]][[ --hwaddr %hwaddr%]] --returniffail --serverbcastip addr add %address%/%bnmask%[[ broadcast %broadcast%]] dev %iface%[[ peer %pointopoint%]][[ label %label%]][[ip route add default via %gateway% dev %iface%[[ metric %metric%]]]]poff[[ %provider%]]pon[[ %provider%]]start-stop-daemon --stop -x wvdial -p /var/run/wvdial.%iface% -s 2start-stop-daemon --start -x wvdial -p /var/run/wvdial.%iface% -b -m --[[ %provider%]]ip addr flush dev %iface%[[ label %label%]]test -f /var/run/udhcpc.%iface%.pid && kill `cat /var/run/udhcpc.%iface%.pid` 2>/dev/null/var/run/ifstatemappingtoo few parameters for line "%s"too many parameters "%s"unknown address type "%s"unknown method "%s"autointerface declared auto twice "%s"sourcesource-diroption with empty value "%s"duplicate option "%s"duplicate script in mapping "%s"misplaced option "%s"/etc/network/interfacesanvfmi:interface %s already configuredinterface %s not configuredRunning mapping script %s on %s don't have all variables for %s/%signoring unknown interface %s/var/run/ifstate.newlinkmanualwvdialpppstaticbootpdhcploopbackinet6v4tunnelcan't extend file limit, max = %dsetrlimitinetd%s: exit status %u%s: exit signal %u%.24s %s/%s: bindparse error on line %u, line is ignoredunixrpc/no support for rpc servicesudpinternalunknown internal service %s%s/%s: unknown service%s/%s: unknown host '%s'/etc/inetd.confR:+feq:+non-root must specify config fileselectaccept (for %s)%s/%s: too many connections, pausing%s: no such %snon-root must run services as himself%02X-[NONE SET]%02X:%02X:%02X:%02X:%02X:%02XcompressedbytesX bytes:%llu (%llu.%u %sB)%sDevice not found%s: error fetching interface information: %s%-9s Link encap:%s HWaddr %s Media:%s(auto) %s addr:%s P-t-P:%s Bcast:%s Mask:%s /proc/net/if_inet6%s:%s:%s:%s:%s:%s:%s:%s inet6 addr: %s/%d Scope:GlobalLinkSiteCompatHostUnknown%4s%4s%4s%4s%4s%4s%4s%4s %08x %02x %02x %02x %20s [NO FLAGS] MTU:%d Metric:%dRX packets:%llu errors:%lu dropped:%lu overruns:%lu frame:%lu compressed:%lu TX packets:%llu errors:%lu dropped:%lu overruns:%lu carrier:%lu collisions:%lu compressed:%lu txqueuelen:%d R TInterrupt:%d Base address:0x%lx Memory:%lx-%lx DMA chan:%x SIOCGIFCONF10base210baseTAUI100baseT100baseTX100baseFXinfinibandInfiniBandsitIPv6-in-IPv4Point-to-Point ProtocolEthernetloopLocal LoopbackunspecUNSPEC%n%llu%u%u%u%u%n%n%n%llu%u%u%u%u%u%llu%llu%u%u%u%u%n%n%llu%llu%u%u%u%u%u%llu%llu%u%u%u%u%u%u%llu%llu%u%u%u%u%u%uIPv6DARPA Internetbad IP address: %suse prefix or netmask, not bothbad netmask: %sNETMASK=%s BROADCAST=%s NETWORK=%s PREFIX=%i can't find hostname for %sHOSTNAME=%s %s : USERID : UNIX : %s fiwb:nobodyinterface name '%s' too longbus=driver=phyaddr=mac=can't parse %sno selectors found for %s/etc/mactabsc:can't change ifname %s to %s10809dN:NBDMAGIClogin failedIHAVEOPTNBD_SET_TIMEOUTNBD_SET_SOCK/sys/block/%.32s/pidblock-sizepersistsent %llu, rcvd %llu punt! listening on %s ... acceptconnect from wrong ip/port %s ignoredIP options: %s connect to %s from %s (%s) %8.8x net timeout net readtoo many output retries-enuvlkzbad local port '%s'udptest first write%s (%s) open %s (%s)??STREAMDGRAMRAWRDMSEQPACKETFREECONNECTINGCONNECTEDDISCONNECTINGLISTENING%*p: %lX %lX %lX %X %X %lu %n[ ACC W N %-5s %-6lu %-11s %-10s %-13s %6lu %-20sADxADHADTAD`ADBDBDADBDBD%08X%08X%08X%08X%s:%s%s/cmdlinefdsocket:[[0000]:%s: bogus data on line %d%*d: %32[0-9A-Fa-f]:%X %32[0-9A-Fa-f]:%X %X %lX:%lX %*X:%*X %*X %d %*d %lu %X%s %6lu %6lu %-*s %-*s %-12s%.20sESTABLISHEDlaentuwxrWpPID/Program name /proccan't scan /proc - are you root?showing only processes with your user IDActive Internet connections (servers and established)(only servers)(w/o servers)Local Address Proto Recv-Q Send-Q %-*s %-*s State %s Foreign Address/proc/net/tcp/proc/net/tcp6/proc/net/udp/proc/net/udp6/proc/net/raw/proc/net/raw6Active UNIX domain sockets Proto RefCnt Flags Type State I-Node %sPath /proc/net/unixSYN_SENTSYN_RECVFIN_WAIT1FIN_WAIT2TIME_WAITCLOSECLOSE_WAITLAST_ACKLISTENCLOSING/etc/resolv.confdomainsearchnameserver%s.%.*s%s name = %s %s canonical name = %s %s nameserver = %s write to '%s'Server: %s Address: %s Query #%d completed in %ums: ** server can't find %s: %s Non-authoritative answer: Name: %s Address: %s MX record too short %s mail exchanger = %d %s %s text = "%s" origin = %s mail addr = %s serial = %lu refresh = %lu retry = %lu expire = %lu minimum = %lu *** Can't find %s: Parse error invalid query type "%s"ip6.arpa%u.%u.%u.%u.in-addr.arpa;; connection timed out; no servers could be reached *** Can't find %s: No answer NOERRORFORMERRSERVFAILNXDOMAINNOTIMPREFUSEDYXDOMAINYXRRSETNXRRSETNOTAUTHNOTZONE11131415SOANSAAAAACNAMEMXTXT PTRANY'%s' is %sduplicate peer %s (%s)executing '%s %s'stratum%s=%ufreq_drift_ppm%s=%ldpoll_intervaloffset%s=%fsettimeofdaycurrent time is %s.%06usetting time to %s.%06u (offset %+fs)update from %s: same or older datapoint, not using itstepadjtimexupdate from:%s offset:%+f delay:%f jitter:%f clock drift:%+.3fppm tc:%dshaonly MD5 and SHA1 keys supportedmalformed key at line %ukeyno:key %u is not defined/etc/ntp.confkeyskipping %s:%u: unimplemented command '%s'ntpdrecvmalformed packet received from %s: size %usend failedrecv(%s) errormalformed packet received from %sinvalid cryptographic hash received from %sreply from %s: peer is unsyncedreply from %s: delay %f is too high, ignoringreply from %s: offset:%+f delay:%f status:0x%02x strat:%d refid:0x%08x rootdelay:%f reach:0x%02xpeer %s unfit for selection: root distance %f too high, jitter:%f, no peer selectedno valid datapoints%sfalsetickers:%d, candidates:%d%ssurvivors:%d%swant smaller interval: offset/jitter = %usending query to %stimed out waiting for %s, reach 0x%02x, next query in %uspoll:%us sockets:%u interval:%usperiodicunsync (DUP!)%d bytes from %s: seq=%u ttl=%d time=%u.%03u ms --- %s ping statistics --- %lu packets transmitted, %lu packets received, %lu duplicates, %lu%% packet loss round-trip min/avg/max = %u.%03u/%u.%03u/%u.%03u ms Destination UnreachablePacket too bigTime ExceededParameter ProblemListener Reductionunknown ICMP typeListener QueryListener ReportEcho ReplySource QuenchRedirect (change route)Timestamp RequestTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyPING %s (%s): %d data bytes ICMP6_FILTERwarning: got ICMP %d (%s)can't set multicast source interfaceD D DpDDD D D D D DDDĸDиDܸDDDDblocked102450005Scanning %s ports %u to %u Port Proto State Service %5u tcp %s %s %u closed, %u open, %u timed out (or blocked) ports /proc/net/ipv6_routeNext HopDestinationKernel IPv6 routing table %-44s%-40sFlags Metric Ref Use Iface %32s%x%*s%x%32s%x%x%x%x%s %s/%d%-43s %-39s %-5s %-6d %-2d %7d %-8s resolving %sSIOCADDRTSIOCDELRTgateway %s is a NETWORKnetmask %.8x and host route conflictbogus netmask %snetmask and route address conflict MSS Window irttMetric Ref Use/proc/net/routeKernel IP routing table Destination Gateway Genmask Flags %s Iface %*[^ ] %63s%lx%lx%X%d%d%d%lx%d%d%d %-15.15s %-15.15s %-16s%-6s%5d %-5d %6d %s %-6d %-2d %7d %s -net-hostA:ne   TIOCSETDcslipprotocolbaud rateTIOCGETDSIOCSIFENCAPes:+r:+n:%x:%x:%xrateCBQ: too short %s optlsswrrfoptCBQ: too short overlimit strategy %u/%u%.0fMbit%.0fKbit%.0fbitrate %s boundedisolated) prio %uprio no-transmitdeleted qdisc %s %x: dev %s root parent %s refcnt %d bands %u priomap multiqueue: o%s class %s %sleaf %x parenthandleprioritycan't send dump requestqdiscstatus %u/%ugot signal %u, exit?exitsignalend %d %s %d%s%s=%sstart %u %s-%s (%s-%s)start %u %s-%sUDPTCPlistening on %s, starting, uid %u, gid %ulistening on %s, startingcan't look up hostname for %sconcurrency %s %u/%uTCPORIGDSTADDRPROTOLOCALADDRREMOTEADDRLOCALHOSTREMOTEHOSTTCPCONCURRENCY Entering %s mode Escape character is '^%c'. Console escape. Commands are: l go to line mode c go to character mode z suspend telnet e exit telnet continuing... al:Connected to %s Connection closed by foreign host EE EEEE/etc/issue.netbad blocksize '%s'can't open fileremote filename is too longoctetblksizetsizeserver error: (%u) %sfalling back to blocksize 512512get-g-rput-pmalformed packetmode is not 'octet'dot in file namercu:l/.HMAC key>64got bad TLS record (len:%d) while expecting %s %02xbad MACdecode errordecrypt errorhandshake failureunrecognized nameshort read, have only %dbad encrypted len:%uencrypted data too shortTLS %s from peer (alert code %d): %shandshake record'server hello'certificatetls error at line %d cipher:%04xnot RSA or ECDSA certelliptic curve is not x25519'server hello done'server cert is not RSAserver did not provide EC keymaster secretkey expansionclient finishedswitch to encrypted traffic'server finished'encrypted data #'+/<=R j068@|9/4CDT{2#=L BN.f($v[Im%rdhԤ\]elpHP^FWث XE,?k:AOgst"57unGq)ʼnobV>Ky xZݨ31Y'_`QJ -zɜ;M*fHa5WiَU(ߌ BhA-Tpstm_montogomery_setup failure RSA crypt outlen:%d < size:%dpkcs1Pad failure Error padding psRsaEncryptPub. Likely data too long psRsaCrypt error: pstm_exptmod psRsaCrypt error: pstm_unsigned_bin_size psRsaCrypt error: pstm_to_unsigned_bin Error performing psRsaEncryptPub Encrypted size error in psRsaEncryptPub OUT-OF-RANGEIPV6_CHECKSUMSO_SNDBUFTOSsetsockopt(%s) %dcan't get probe addrtraceroute to %s (%s), %d hops max, %d byte packets %2dUNICAST_HOPSTTLsent %d octets, ret=%dpacket too short (%d bytes) from %s %d bytes from %s to %s: icmp type %d (%s) code %d %2d: x%8.8x %04x: %s %s (%s) %d bytes to %s %u.%03u ms (%d) ! !N !H !P !F-%d !S !A !C !V !U !I !T !<%d> *ICMP 1ICMP 2Dest UnreachableRedirectICMP 6ICMP 7EchoRouter AdvertRouter SolicitParam ProblemTimestampInfo RequestInfo ReplyPacket Too BigEcho RequestMembership QueryMembership ReportMembership ReductionNeighbor SolicitNeighbor Adverttap%d/dev/net/tunSet '%s' nonpersistent Set '%s' %spersistent and owned by uid %ld gid %ldioctl error for %sdownload timed outsocketpair%s:%uopenssls_client-quiet-connect-servernamerestart failednote: TLS certificate validation not implementederror getting responsenot an http or ftp url: %sbad header line: %swriting to stdout saving to '%s' bad chunk length '%s'connection closed prematurelywritten to stdout '%s' saved %s%s --> %s%s ftp_proxyhttp_proxyGETWgetindex.htmlGET %s://%s/%s HTTP/1.1 %s /%s HTTP/1.1 Host: %s User-Agent: %s Connection: close Proxy-Authorization: Basic %s Range: bytes=%llu- Content-Type: application/x-www-form-urlencoded Content-Length: %u %sserver returned error: %scontent-length %s is garbagechunkedtransfer encoding '%s' is not supportedtoo many redirectionsUSER PASS ftp login: %sSIZE bad SIZE value '%s'bad response to %s: %sPROT PRETR remote file exists ftp error: %s[Querying %s:%d '%s%s'] domain:domain name:whois server:whois:domain [%s] %swhois.iana.org[Redirected to %s] %s %s %sip=%sscript %s %s failed, exitcode=%d169.254.0.0invalid network addressinvalid link addressinterfaceSIOCGIFHWADDRstart, interface %siface %s is downdeconfig can't send flush requestwrong nlmsg len %dDeleted inet inet6 family %d peer %s/%d brd %s any %s scope %s secondary tentative dadfailed deprecated dynamic flags %02x valid_lft forevervalid_lft %dsec preferred_lft forever preferred_lft %dsec %snil ifname%d: %s@NONE: @%s: NO-CARRIER,,M-DOWNmtu %u qdisc %s master %s state %s SIOCGIFTXQLENqlen %d%c link/%s peer brd scopelocalneed "dev IFACE""dev" (%s) must match "label" (%s)broadcast can be set only for IPv4 addressesflushcan't flush link addressesvlantype vlanunknown VLAN encapsulation protocol '%s'argument of "%s" must be "on" or "off"vrftabletype vrfqlen"dev"wrong address (%s) length: expected %d bytesSIOCSIFHWADDRSIOCSIFNAMESIOCSIFTXQLENSIOCSIFMTU"ip neigh flush"nud statecan't find device '%s'flush terminatedNothing to flush*** Flush is complete after %d round(s) *** *** Round %d, deleting %d entries *** *** Flush not complete bailing out after %d roundsdump terminatednot RTM_NEWNEIGH: %08x %08x %08xBUG: wrong nlmsg len %dlladdr %s router proxy ref %d used %d/%d/%d probes %u%cINCOMPLETE%cREACHABLE%cSTALE%cDELAY%cPROBE%cFAILED%cNOARP%cPERMANENTNot a route: %08x %08x %08x %s/%u 0/%d default from %s/%u from %s from 0/%u via %s table %s src %s metric %d dead onlink pervasive notify %c cache expires %dsec error %d iif %sneed at least destination addressnot a route?wrong len %dcan't connect the route4&F&F&F&F&F'F'F"ip route flush"-1can't flush routing cache8F8FL8F8F8Fl8Fx8F8F8F8F8F8F8Ftable ID%u: from %s/%u0/%dto %s/%u to 0/%d tos %s fwmark %#x iif %s lookup %s %s %d realms %s/map-to %s masqueradeSIOCGETTUNNELyou managed to ask for more than one%s tunnel modecan't guessikeyokeygreipipkeys are not allowed with ipip and sitbroadcast tunnel requires a source addressSIOCCHGTUNNELSIOCADDTUNNELttl != 0 and noptmudisc are incompatibletunl0gre0sit0can't determine tunnel mode (ipip, gre or sit)SIOCDELTUNNELipipv6any%s: %s/ip remote %s local %s SIOCGIFNAME dev %s ttl %d ttl inherit tos inherit%c%s nopmtudisc key %s ikey %s okey %s %c Drop packets out of sequence. %c Checksum in received packet is required.%c Sequence packets on output.%c Checksum output packets.wrong format of /proc/net/dev%lu%lu%lu%lu%lu%lu%lu%*d%lu%lu%lu%lu%lu%lu%lucan't get type of [%s]ERROR truncatedOVERRUNEOF on netlinksender address length == %dRTNETLINK answersmessage truncatedremnant of size %d!can't talk to rtnetlinktruncated messagemalformed message: len=%d!unexpected reply!deficit %d, rta_len=%d!"%s" is invalid lladdrif%d[%d]/etc/iproute2/rt_%sdatabase %s is corrupted at line %dglobalnowheresitescopesrealmsdsfieldmaintablesprotoskernelgatedramrtzebrabirdunicastanycastblackholeunreachableprohibitthrownatxresolvexxFwFwFxF xFxF$xF0xF : %s : %shpet[kernel module]/proc/timer_stats total eventsextra timer interrupttick_nohz_tick_setup_sched_timer%15.15s : %s/proc/acpi/processor%s/%s/powerage[ation[run as root to collect enough informationCollecting data for 10 seconds0 1 C-state information is not available Cn Avg residency C0 (cpu running) (%4.1f%%) C%u %5.1fms (%4.1f%%) Wakeups-from-idle in %u seconds: %llu Top causes for wakeups: KMGTPEZY %5.1f%% (%s) %s no stats available; run as root or enable the timer_stats module%*u%*d%.6s,bad -o argument '%s', supported arguments: %s mgtpezy%2u:%02u%2uh%02u%2ud%02u%4ludZo:*aAdeflTpid,user,time,args%-*s %.*s %*sGROUPPIDPPIDPGIDELAPSEDNIRGROUPRUSERVSZSIDRSS-+----`-|-| %d*[\\\%03o{%.*s}no processes found/proc/invalid process id: '%s'/proc/%u/cwd%o%lloustar %06osmapscmdlinesetterror: malformed setting '%s'error: '%s' is an unknown keyerror %sing key '%s'%s = error reading key '%s'error: '%s' must be of the form name=value+neAapwq/etc/sysctl.conf/proc/sys;#= 100% %.*s Mem total:%lu anon:%lu map:%lu free:%lu slab:%lu buf:%lu cache:%lu dirty:%lu write:%luSwap total:%lu free:%lu PID VSZ VSZRW RSS (SHR) DIRTY (SHR) STACK COMMAND %.*s^_%s Mem: %luK used, %luK free, %luK shrd, %luK buff, %luK cachedCPU%s:%susr%ssys%snic%sidle%sio%sirq%ssirqLoad average: PID PPID USER STAT VSZ %VSZ CPU %CPU COMMAND %5u%6u %-8.8s %s %.5s%3u.%c %3d%3u.%c d:n:bHmno process info in /proc%04u-%02u-%02u %02u:%02u:%02u %02u:%02u:%02u up %u day%s, %u min, %u users, load average: %u.%02u, %u.%02u, %u.%02u Every %.1fs: %-*sreaddir %swarning: %s/%s is a directoryopen %s/%sread %s/%sGIDUID%s: warning: can't %s%s%s: warning: cannot open %s%s: fatal: can't %s%slog/supervise/pid.newlog/supervise/pidlog/supervise/stat.newlog/supervise/statlog/supervise/status.newlog/supervise/status, paused, got TERM, want down, want exitwrite stat %s: fatal: %s exists but is not a fifocontrol/?vfork for setup stdout for run wait for child start log/start ./finish./runvfork, sleeping./logstat ./logstat log/down: log is not a directorylog/down: name too longreadlink ./superviselog/supervise/locklock supervise/locklog/supervisereadlink ./log/supervisechange back to service directorylock log/supervise/locklog/supervise/controllog/supervise/okcan't %s: warning: %s%s%srunsvstart runsv open directory read directory open current directorychange directory, pausingchange directory to %s%s%s: %s: %mwarning: fail: warning: can't stat %s/downdown: run: finish: (pid %d) %us, normally down, normally up, want upcheckwarning: can't stat %s/check./checkrunwarning: can't %s child %s/checkwait forfatal: can't %srunsv not runningok: can't open supervise/okcan't open supervise/statuscan't read supervise/statuscan't read supervise/status: bad format; can't change directorycan't open supervise/controlcan't write to supervise/control/var/serviceSVDIRSVWAITtctry-restartshutdowntcureloadforce-reloadforce-restartforce-shutdownforce-stopcan't change to service directorychange to original directorykill: timeout: udopchaitkxsvhangupinfo: sig%s receivedalarmtermwarning: %s: %spausing: can't %s %sopen directory, want rotatecan't unlink processor leftovercan't read directoryinfo: delete: %s/%scan't unlink oldest logfileinfo: close: %sfsync current logfileset mode of currentprocessor already runningvfork for processorinfo: processing: %s/%sopen state forfatal: can't %s processor %snewstatechange to initial working directorypausing: can't %scan't open log directorycan't lock directorywarning: %s/configinfo: read: %s/configpausing: out of memoryrename currentcan't stat currentopen currentinfo: append: %s/currentinfo: new: %s/currentno functional log directoriesfatal: %swait for processorchange directory, want processorprocessor failed, restartrename processedset mode of processedwarning: can't unlink: %s/%srename stateinfo: processed: %s/%schildchange directory, want rotateinfo: rename: %s/current %s %ucreate new currentcan't read standard inputwarning: %schange directory, want remove old logfileopen directory, want remove old logfilecan't read directory, want remove old logfilewarning: out of disk space, delete: %s/%swrite to current%04u-%02u-%02u%c%02u:%02u:%02u.%06u000m<h |HH|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H}H}H}H}H}H}H4}H4}HP}HP}H|Hline %d: %.*s: is read only%.*s: bad variable name%lu.%06uIllegal number: %s%d: %mcan't set tty process group: %millegal option -%cno arg for -%c optionvfunalias%s: %s not found LPNo current jobNo previous job%s: ambiguous%s: no such jobjob %s not created under job controlcan't access tty; job control turned offOLDPWDPWDloginillegal option %co %s%-16s%s set %co %s illegal option %c%cBuilt-in commands: ------------------ can't open '%s': %mYou have stopped jobs. Done(%d) (core dumped)[%d] Running %*c%d %s%*c%s%s%04o illegal mode: %sexpression expected%s=%s %lld"}$(...)${${#))$((trapjobstrap -- %s %s %s: invalid signal specification%um%u.%03us%c%s%s%.*s%s np -%u-lunexpected %s (expecting %s)HHxHxHxHDHDHDHHDHDHPHxHHHH|>>>&<&<>if ; then ; else ; do for in case ;; H|HpHpH`HTHHHHH|HHH|HHHlH PS4=+ RANDOMEPOCHSECONDSEPOCHREALTIMEeerrexitfnoglobIignoreeofmmonitornnoexecxxtracevverboseCnoclobberaallexportbnotifyunounset/sys/class/tty/console/activeS%ufatal recursion (depth %u)syntax error: unterminated %sBUG in setvar%s: readonly variablePWD=%sBUG in varexp4%s: bad arguments%s: not in a function or sourced script%s: only meaningful in a loop%%%ubad argument '%s'%u: no such job%-10s%s [%u] %u %s [%u] %-22s %.40s Stopped%s: no current jobkill (SIGCONT)!+vfunset: -v and -f are exclusiveBUG: nesting underflowumask%s: invalid mode '%s'trap -- trap: %s: invalid signal specificationtrap: invalid arguments*?[\{}'%s': bad variable namereadonly %s %s: not in a function!nexport %.*ssyntax errorsyntax error: unexpected %s\"'`$(){}[]<>;#&|~*?!^  %s is %s %s: %s: invalid optionLINENO%.*s/%scd: %sa shell builtintype: %s: not foundglob error %d on '%s'usage: getopts OPTSTRING VAR [ARGS]+%s! ! commandsyntax error at '%s'not a valid identifier in for{}<>;&|()#$"`here documentBUG: unexpected %c-nwait: '%s': not a pid or valid job specwait: pid %d is not a child of this shellwait %s!srn:p:t:u:d:PS1PS2unexpected EOF in here documentambiguous redirect${name}_*@$!?#-\/%#:-=+?999999999$`\ BUG in varexp2invalid redirectmalformed forparameter null or not set%s: substring expression < 0$%s: cannot assign in this wayHUSH_VERSION+c:exinsl.hush_historyYJZJ|ZJZJZJZJXJZJZJYJZJ|ZJZJZJZJZJtZJZJZJZJZJ|ZJ!ifthen8elifelse fifor whileuntilin do done case @esac@[echoprintfpwdtestRun commands in filebgResume job in backgroundbreakExit loopcdChange directorycontinueStart new loop iterationevalConstruct and run shell commandexecExecute command, don't return to shellSet environment variablesBring job to foregroundgetoptshelphistoryShow historyList jobsSend signals to processesSet local variablesInput into variableMake variables read-onlyreturnReturn from functionSet positional parametersshiftShift positional parameterstimesTrap signalstrueShow command typeulimitControl resource limitsSet file creation maskunsetUnset variablesWait for process to finish<> >><><<arithmetic syntax errorexponent less than 0malformed ?: operatorexpression recursion loop detectedunlimitedinvalid file descriptorinvalid timeoutinvalid countread: '%s': not a valid identifierREPLY%-32s(-%c) error setting limitcore file size (blocks)data seg size (kb)scheduling priorityfile size (blocks)pending signalsmax locked memory (kb)max memory size (kb)open filesPOSIX message queues (bytes)real-time prioritystack size (kb)cpu time (seconds)max user processesvirtual memory (kb)file locksc:nklogd started: %sklogdklogctl(2) errorklogd: exitingsemop[SMrup]fFfindcan't %s syslogd bufferaccesscan't get access to semaphores for syslogd buffersemop[SMrdn]/dev/log/dev/console<%d>%s <%d>%s %.64s %s %s SMwdnSMwup%s.%s/etc/syslog.conferror in '%s' at line %dsyslogdshmgetshmatsemget/dev/kmsgsyslogd started: BusyBox v1.31.0read from %ssyslogd exitingp:st:facilityunknown %s name: %s/var/log/messagesauthauthprivcrondaemonkernlprmarknewssecuritysysloguucplocal0local1local2local3local4local5local6local7alertcritdebugemerginfonoticepanicwarnwarning/etc/acpi/dev/input/event/var/log/acpid.log/etc/acpid.conf/etc/acpi.map/var/run/acpid.pid./%srun-partsPWRFPWRF/00000080LID0LID/00000080EV_KEYKEY_POWERbutton/power PWRF 00000080button/power PWRB 00000080EV_SWSW_LIDbutton/lid LID0 00000080BLKSECDISCARDBLKDISCARDBLKGETSIZE64%s: %s failed%lld ] ] ^ h p@qr@` r@a _ %*s%*sjy%B%a%s %u%*s%s %s %s%*s%s%*s%sSCHED_%s min/max priority : %u/%u SCHED_%s not supported can't %cet pid %u's policypid %u's %s scheduling policy: SCHED_%s can't get pid %u's attributespid %u's %s scheduling priority: %d cs:+n:+rklogctlnot a sg device or old sg driverfallocate '%s'invalid character '%c'FAT_IOCTL_GET_ATTRIBUTESFAT_IOCTL_SET_ATTRIBUTESfalse mode "%ux%u-%u" # D: %.3f MHz, H: %.3f kHz, V: %.3f Hz geometry %u %u %u %u %u timings %u %u %u %u %u %u %u accel %s rgba %u/%u,%u/%u,%u/%u,%u/%u endmode /etc/fb.modes# endmode%d %d %d %d %d%d %d %d %d %d %d %dlow%d/%d,%d/%d,%d/%d,%d/%dFBIOPUT_VSCREENINFOunknown video mode '%s'JJ,J,JdJdJdJJJfbdba i gtaccelhsyncvsynclaceddouble show s all xresdyresevxresfvyresgdepthhmatchigeometrypixclockjleftkrightluppermlowernhslenovslenptimingscsyncqgsyncrextsyncsbcasttrgbaustepvmovewDoubleSingle%s: not a block deviceFDGETPRM%s-sided, %u tracks, %u sec/track. Total capacity %d kB Formatting... FDFMTBEGFDFMTTRK%3dFDFMTENDVerifying... problem reading cylinder %d, expected %d, read %dbad data in cyl %d Continuing... cylinderssectorsDisk %s: %llu %cB, %llu bytes, %u sectors %u cylinders, %u heads, %u sectors/track Units: %s of %u * %u = %u bytes The number of cylinders for this disk is set to %u. There is nothing wrong with that, but this is larger than 1024, and could in certain setups cause problems with: 1) software that runs at boot time (e.g., old versions of LILO) 2) booting and partitioning software from other OSs (e.g., DOS FDISK, OS/2 FDISK) /dev/hd/proc/ide/%s/mediacdromtapeUnknown value(s) for: heads sectors cylinders (settable in the extra functions menu)Command Actiona toggle a bootable flagb edit bsd disklabelc toggle the dos compatibility flagd delete a partitionl list known partition typesn add a new partitiono create a new empty DOS partition tablep print the partition tableq quit without saving changess create a new empty Sun disklabelt change a partition's system idu change display/entry unitsv verify the partition tablew write table to disk and exitx extra functionality (experts only)can't seek on %s%u,%u,%uThe partition table has been altered.Calling ioctl() to re-read partition tableWARNING: rereading partition table failed, kernel still uses old table%c%2x %-22.22s%s (%u-%u, default %u): %s (%u-%u): Using default value %u Value is out of rangePartition numberWarning: partition %u has empty type Selected partition %u No partition is defined yet!All primary partitions have been defined already!Partition %u has different physical/logical start (non-Linux?): phys=(%u,%u,%u) logical=(%u,%u,%u) Partition %u has different physical/logical end: Disk %s: %u heads, %u sectors, %u cylinders Nr AF Hd Sec Cyl Hd Sec Cyl Start Size ID%2u %02x%4u%4u%5u%4u%4u%5u%11u%11u %02x Warning: bad start-of-data in partition %u Partition %u contains sector 0 Partition %u: head %u greater than maximum %u Partition %u: sector %u greater than maximum %u Partition %u: cylinder %u greater than maximum %u Partition %u: previous sectors %u disagrees with total %u Warning: partition %u overlaps partition %u Warning: partition %u is empty Logical partition %u not entirely in partition %u Total allocated sectors %u greater than CHS size %u %u unallocated sectors partDevice%-*s Boot StartCHS EndCHS StartLBA EndLBA Sectors Size Id Type disc%*.*s%s%-2u%s%s %-11s %-11s %10u %10u %10u %s %2x %s Partition table entries are not in disk order'%s' is opened for read only can't read from %sNote: sector size is %u (not 512) device has more than 2^32 sectors, can't use all of themDevice contains neither a valid DOS partition table, nor Sun, SGI, OSF or GPT disklabelIgnoring extra extended partition %u Bad offset in primary extended partitionWarning: deleting partitions after %u Warning: extra link pointer in partition table %u Warning: ignoring extra data in partition table %u Omitting empty partition (%u) Warning: invalid flag 0x%02x,0x%02x of partition table %u will be corrected by w(rite) DOS disklabelDisk %s doesn't contain a valid partition table /proc/partitions %u %u %u %[^ ]cylinderFirst %sSector %u is already allocated No free sectors availableLast %s or +size{,K,M,G,T}l logical (5 or over)e extendedb:+C:+H:+lS:+uCommand (m for help): WARNING: Partition %u is an extended partition %c: unknown command DOS Compatibility flag is %sset not The maximum number of partitions has been createdYou must delete some partition and add an extended partition firstPartition type p primary partition (1-4) %s Invalid partition number for type '%c' Partition %u does not exist yet! Hex code (type L to list codes): Type 0 means free space to many systems (but not to Linux). Having partitions of type 0 is probably unwise.You cannot change a partition into an extended one or vice versaChanged system type of partition %u to %x (%s) Changing display/entry units to %s Expert command (m for help): Partition %u has no data area New beginning of dataRecalculate C/H/S values? (Y/N): Number of cylindersDevice: %s 0x%03X: %02XOrdering is already correct Number of headsNumber of sectorsWarning: setting sector offset for DOS compatibilityb move beginning of data in a partitionc change number of cylindersd print the raw data in the partition tablee list extended partitionsf fix partition orderh change number of headsr return to main menus change number of sectors/track Kt Kt K KHKHKHKHK KHKHK$ KXK4 K K K KHKt K K\KKKKKKtKKKKKPKK K K K K KKKKd KK K KKK KK (FAT12FAT16 <32MExtendedFAT16HPFS/NTFS OS/2 Boot Manager Win95 FAT32 Win95 FAT32 (LBA)Win95 FAT16 (LBA)Win95 Ext'd (LBA)Hidden FAT12Compaq diagnosticsHidden FAT16 <32MHidden FAT16Hidden HPFS/NTFSHidden Win95 FAT32Hidden W95 FAT32 (LBA)Hidden W95 FAT16 (LBA)